DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and cyn-2

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_499828.1 Gene:cyn-2 / 176807 WormBaseID:WBGene00000878 Length:172 Species:Caenorhabditis elegans


Alignment Length:171 Identity:113/171 - (66%)
Similarity:133/171 - (77%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LPR--VFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFG-------YKGSIFHRVIP 121
            :||  ||||:|...:..|||||||.:|:|||||||||||||||||.|       :|||.|||:||
 Worm     1 MPRVKVFFDITIGGKKGGRIVMELYNDIVPKTAENFRALCTGEKGKGKSGKKLHFKGSKFHRIIP 65

  Fly   122 NFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLD 186
            .||.||||||..|||||:||:|.||.||||:.||||.|:|||||.||||||||||:|||||.|||
 Worm    66 EFMIQGGDFTEGNGTGGESIHGEKFDDENFKEKHTGPGVLSMANCGANTNGSQFFLCTVKTTWLD 130

  Fly   187 NKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            .||||||:|:||:||||.|||.||:.|..|...::|:.|.:
 Worm   131 GKHVVFGKVIEGMDVVKAIESKGSEDGAPSAPCVIADCGEM 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 112/166 (67%)
cyn-2NP_499828.1 cyclophilin_ABH_like 5..169 CDD:238907 110/163 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 237 1.000 Domainoid score I1296
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 245 1.000 Inparanoid score I2047
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - mtm4827
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.