DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and cyn-16

DIOPT Version :10

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_496562.3 Gene:cyn-16 / 174843 WormBaseID:WBGene00000892 Length:483 Species:Caenorhabditis elegans


Alignment Length:134 Identity:59/134 - (44%)
Similarity:74/134 - (55%) Gaps:20/134 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 NEPL-----------GRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDF 130
            |||:           |.|.:||.:...|....||..||....   |||::|||::.||:.||||.
 Worm     7 NEPITTGKVTLETTAGDIEIELWTKEAPLACRNFIQLCMENY---YKGTVFHRLVKNFILQGGDP 68

  Fly   131 TNHNGTGGKSIYGNKFPDE-NFELKHTGSGILSMANAGANTNGSQFFICTV---KTAWLDNKHVV 191
            | ..||||:||||..|.|| :..||....||:.|||||.:.||||||. |:   ....||.||.:
 Worm    69 T-ATGTGGESIYGKPFKDEIHQRLKFNRRGIVGMANAGRDDNGSQFFF-TIGDRGAPELDKKHTI 131

  Fly   192 FGEV 195
            ||:|
 Worm   132 FGKV 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 59/134 (44%)
cyn-16NP_496562.3 cyclophilin_CeCYP16-like 8..175 CDD:238906 58/133 (44%)
CWC27_CTD 369..446 CDD:412084
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.