DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and cyn-4

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_496337.1 Gene:cyn-4 / 174674 WormBaseID:WBGene00000880 Length:523 Species:Caenorhabditis elegans


Alignment Length:199 Identity:75/199 - (37%)
Similarity:98/199 - (49%) Gaps:29/199 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AAAFQIAESA-ILANKSITLASSACSVNRGQLQFGIQIVREYSKASKMSTLPRVFFDMTADNEPL 80
            ||.|.....| :.:||:..|.:..              || ||:..|     ..|..:..:..||
 Worm   247 AAGFTSTVMAPVTSNKAAVLDNDT--------------VR-YSRVKK-----NAFVRLVTNFGPL 291

  Fly    81 GRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNK 145
            .   :||.:..|||..|||...|:  .|: |..:.|||:|.|||.||||.|. .|.||:||:...
 Worm   292 N---LELFAPKVPKACENFITHCS--NGY-YNNTKFHRLIKNFMLQGGDPTG-TGHGGESIWDKP 349

  Fly   146 FPDENFE-LKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYG 209
            |.||... ..|...|:|||||.|:|||||||||......:||.||.:||.:|.|.|.:..||...
 Worm   350 FSDEFISGFSHDARGVLSMANKGSNTNGSQFFITFRPCKYLDRKHTIFGRLVGGQDTLTTIEKLE 414

  Fly   210 SQSG 213
            ::.|
 Worm   415 TEEG 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 63/148 (43%)
cyn-4NP_496337.1 Ubox 45..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 63/145 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.