DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and cyn-5

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001379232.1 Gene:cyn-5 / 173374 WormBaseID:WBGene00000881 Length:204 Species:Caenorhabditis elegans


Alignment Length:198 Identity:106/198 - (53%)
Similarity:136/198 - (68%) Gaps:10/198 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KSITLASSACSVNRGQLQFGIQIVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKT 95
            ||:.:.::..:|  |.|..|     :.:|..|::  .:|:|||....:|:||||:.|....||||
 Worm     2 KSLLVVAAVLAV--GALAQG-----DDAKGPKVT--DKVYFDMEIGGKPIGRIVIGLFGKTVPKT 57

  Fly    96 AENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGI 160
            |.||..|....||.||.||.|||||.:||.||||||..:||||:||||.||.||||:|||.|:|.
 Worm    58 ATNFIELAKKPKGEGYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGW 122

  Fly   161 LSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKK-IIVANS 224
            ||||||||:||||||||.||||.|||.:|||||:::||:|||:|||......|...|: :|:|.|
 Worm   123 LSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTEKLPGDRPKQDVIIAAS 187

  Fly   225 GSL 227
            |.:
 Worm   188 GHI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 96/158 (61%)
cyn-5NP_001379232.1 cyclophilin 29..188 CDD:412213 96/158 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.