DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and PPIF

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_005720.1 Gene:PPIF / 10105 HGNCID:9259 Length:207 Species:Homo sapiens


Alignment Length:200 Identity:133/200 - (66%)
Similarity:157/200 - (78%) Gaps:14/200 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KSITL---ASSACSVNRGQLQFGIQIVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVV 92
            :|:.|   |:.|||...|.           ..:|..|..|.|:.|:.|:.:||||:|:||::|||
Human    18 RSVPLRLPAARACSKGSGD-----------PSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVV 71

  Fly    93 PKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTG 157
            ||||||||||||||||||||||.||||||:||||.||||||||||||||||::||||||.|||.|
Human    72 PKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVG 136

  Fly   158 SGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVA 222
            .|:|||||||.|||||||||||:||.|||.||||||.|.||:||||||||:||:||:|||||::.
Human   137 PGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVIT 201

  Fly   223 NSGSL 227
            :.|.|
Human   202 DCGQL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 122/157 (78%)
PPIFNP_005720.1 cyclophilin_ABH_like 46..204 CDD:238907 122/157 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 265 1.000 Domainoid score I1907
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38696
Inparanoid 1 1.050 275 1.000 Inparanoid score I2973
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - otm41055
orthoMCL 1 0.900 - - OOG6_100528
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R284
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.