DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and LOC100911252

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_038964534.1 Gene:LOC100911252 / 100911252 RGDID:6493676 Length:164 Species:Rattus norvegicus


Alignment Length:161 Identity:121/161 - (75%)
Similarity:136/161 - (84%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFT 131
            |.||||:|||.|||||:..||.:|.|||||||||||.|||||||||||.|||:||.|||||||||
  Rat     4 PTVFFDITADGEPLGRVCFELFADEVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFT 68

  Fly   132 NHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVV 196
            .|||||||||||.||.||||.|||||.|||||||||.|||||||||||.||.|||.||||||:|.
  Rat    69 CHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVK 133

  Fly   197 EGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227
            ||:.:|:.:|.:||::|||||||.:::.|.|
  Rat   134 EGMSIVEAMERFGSRNGKTSKKITISDCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 119/157 (76%)
LOC100911252XP_038964534.1 cyclophilin_ABH_like 4..162 CDD:238907 119/157 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100528
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.