DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ppie

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_004911676.2 Gene:ppie / 100495035 XenbaseID:XB-GENE-979639 Length:319 Species:Xenopus tropicalis


Alignment Length:164 Identity:108/164 - (65%)
Similarity:129/164 - (78%) Gaps:0/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQ 126
            |:...|:|:.|:...|:|.|||...||:|:||.|.||||.||..|||||||||.|||:||.||.|
 Frog   153 KVRANPQVYMDIKIGNKPAGRIRFLLRADIVPMTVENFRCLCNHEKGFGYKGSSFHRIIPQFMLQ 217

  Fly   127 GGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVV 191
            .||||||||||||||||.||.||||.|||||.|:|||||:|||||||||||...||.|||.||||
 Frog   218 AGDFTNHNGTGGKSIYGRKFDDENFILKHTGPGLLSMANSGANTNGSQFFITCDKTDWLDGKHVV 282

  Fly   192 FGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSG 225
            ||||:||:|||::||:.|.:.||..:|:|:::.|
 Frog   283 FGEVMEGMDVVRQIEAQGGKDGKPKQKVIISDCG 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 106/157 (68%)
ppieXP_004911676.2 RRM_PPIE 30..100 CDD:409783
cyclophilin_ABH_like 158..316 CDD:238907 106/157 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563773at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.