DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and ppic

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_002931773.2 Gene:ppic / 100494684 XenbaseID:XB-GENE-948735 Length:208 Species:Xenopus tropicalis


Alignment Length:182 Identity:99/182 - (54%)
Similarity:122/182 - (67%) Gaps:2/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GQLQFGIQIVREYSKASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGF 109
            |.:.|.......|.|...:.| .:|||::.......||||:.|...|||||.:||.||.|||||:
 Frog    11 GLVLFLFSTAHGYRKRGPVVT-AKVFFNVEIGGTDAGRIVIGLFGKVVPKTVKNFVALATGEKGY 74

  Fly   110 GYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQ 174
            |||||.|||||.:||.||||.||.:|||||||||..||||||:|||.|.|.:||||||.:|||||
 Frog    75 GYKGSRFHRVIKDFMIQGGDVTNGDGTGGKSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQ 139

  Fly   175 FFICTVKTAWLDNKHVVFGEVVEGLDVVKKIE-SYGSQSGKTSKKIIVANSG 225
            |||.|.:..||:.||||||:|:||:.||..|| ...::..:..|..::.|||
 Frog   140 FFISTTRPLWLNGKHVVFGKVLEGMAVVHLIELQQTNERDQPLKDCVIVNSG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 92/158 (58%)
ppicXP_002931773.2 cyclophilin 33..191 CDD:294131 92/157 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.