DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and Nktr

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_038938667.1 Gene:Nktr / 100364165 RGDID:2321593 Length:1516 Species:Rattus norvegicus


Alignment Length:187 Identity:90/187 - (48%)
Similarity:117/187 - (62%) Gaps:19/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 CSVN----RGQLQFGIQIVREYSKASKMSTL-------PRVFFDMTADNEPLGRIVMELRSDVVP 93
            |||.    |.:.|..::..|..|:...::.|       |:..||:..:.||:|||:.:|.||:.|
  Rat    28 CSVGDVRLRRRRQGVLRSCRASSRRRPVAALAMGAQDRPQCHFDIEINREPVGRIMFQLFSDICP 92

  Fly    94 KTAENFRALCTGEKGFG--------YKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDEN 150
            ||.:||..||:||||.|        ||||.||||:.|||.|||||:..||.||:||||..|.|||
  Rat    93 KTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDEN 157

  Fly   151 FELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIES 207
            |.|||..:.:|||||.|.:||||||||.|.....||..|||||.|:.|.:|:::||:
  Rat   158 FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIEN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 82/149 (55%)
NktrXP_038938667.1 cyclophilin 66..233 CDD:412213 82/149 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.