DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp1 and LOC100333141

DIOPT Version :9

Sequence 1:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_002667876.2 Gene:LOC100333141 / 100333141 -ID:- Length:245 Species:Danio rerio


Alignment Length:161 Identity:91/161 - (56%)
Similarity:115/161 - (71%) Gaps:1/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTN 132
            :||||:|.....:||||:.|..:|.|.|.:||.:|.|||||:|||||.|||||.:||.||||||.
Zfish    72 KVFFDITVGGHEVGRIVIGLFGEVAPLTVQNFVSLATGEKGYGYKGSKFHRVIKDFMIQGGDFTA 136

  Fly   133 HNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVE 197
            .:||||||||||.|.||||.|:|.|:|.:||||||.:||||||||...:..|||.||||||:|:|
Zfish   137 GDGTGGKSIYGNMFADENFRLRHLGAGWVSMANAGPDTNGSQFFITLARAPWLDGKHVVFGKVLE 201

  Fly   198 GLDVVKKIESYG-SQSGKTSKKIIVANSGSL 227
            |:.||..||... ::......:.::.|||.:
Zfish   202 GMAVVHTIELQDTNERNLPYTECVIVNSGKI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 89/157 (57%)
LOC100333141XP_002667876.2 cyclophilin 71..230 CDD:294131 89/157 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53630
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.