DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3632 and YMR1

DIOPT Version :9

Sequence 1:NP_001096996.1 Gene:CG3632 / 32589 FlyBaseID:FBgn0030735 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_012644.1 Gene:YMR1 / 853574 SGDID:S000003871 Length:688 Species:Saccharomyces cerevisiae


Alignment Length:564 Identity:151/564 - (26%)
Similarity:243/564 - (43%) Gaps:160/564 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 MSNRLQRSVRYESDFK-----NEVARLGFDLKGS---WRISTANADFKLCPSYPPKLLVPCCITD 264
            :||.|:|.:.....:.     .|..|.|.|.|..   ||:||.|..::.||:||.||.||...:|
Yeast   142 ISNNLERKLPSPDSWDIYDPIKEFRRQGLDSKDETCPWRLSTVNEHYEFCPTYPSKLFVPRSTSD 206

  Fly   265 EMLHNVANFRGSRRLPAVVWRHQKSGAILARCSQPEVGWLGWRNTRDEQLLKALADACAFDRGEH 329
            .:|.:.:.||..:|:|.:.:.|:.:...:.|.|||..|.:..|:.:||:|:            ..
Yeast   207 ILLKHASKFRSQKRIPVLTYHHKATDCNILRSSQPLPGLINQRSIQDEKLV------------WE 259

  Fly   330 ARHSTCANAKAQPTKGSKETNGQSGLSGKSSPSLDDSSHEELTLDEIKKILIVDARSYTSAVTNR 394
            :.:|.|       .|..:.|                            |.:|||||..|:|:...
Yeast   260 SFNSFC-------NKDIRRT----------------------------KHVIVDARPRTNALAQM 289

  Fly   395 ARGGGCECIEYY-----------------PCAEIEFMNLGNIHAI-RKSFHAVRQLCASS----P 437
            |.|||.|.::.|                 |.....|:.:.|||.: ..:.:....:|...    |
Yeast   290 ALGGGTENMDNYNFFLADNNMGVDKSLKLPTVTRLFLGIDNIHIVSNTAAYMTEVICQGGDLNLP 354

  Fly   438 DDPNWYGQLEKTMWMQHLSGLLGATMTVVHTIEKNGRPVLVHCSDGWDRTPQIVATAQLCLDPYY 502
            .:.|.....:.:.|::..:.:|.:...::.:|..|...||||||||||||.|:|:..::||||:|
Yeast   355 LEQNLIRSQKFSNWLKLNTLILKSVDMLLKSIIFNHSNVLVHCSDGWDRTSQVVSLLEICLDPFY 419

  Fly   503 RTVEGFRVLVEREWLNFGHKFADRSG----------------------NGPNSD----------- 534
            ||.|||.:|||::|.:|||:|.:|||                      ||.:.|           
Yeast   420 RTFEGFMILVEKDWCSFGHRFLERSGHLNSDIRFHDNTMHSNFNDVDTNGDDLDIGVNTQDDYAE 484

  Fly   535 -------------------------EVNER-----CPVFLQWLDLVHQIHRQYPCSFEFSISYLI 569
                                     ::|::     .|||.|:||.|:|:..|.|..|||:..:|.
Yeast   485 DDEGGEDETNLINLSRISKKFNENFKLNKKSLKFVSPVFQQFLDCVYQLLTQNPDLFEFNERFLR 549

  Fly   570 KLAQHSLSCLFGTFLCNSLRERIENSVFDRTFSVWPFL--AETMYRNP---------LYKH---- 619
            :|..|..||.:||||.||.:|:.:.::.::|.|||.:.  ....:.||         :.:|    
Yeast   550 RLVYHLYSCQYGTFLSNSEKEKFQQNLPNKTKSVWDYFRSRRKQFINPNFIQRKRSGMNEHDQNL 614

  Fly   620 -ETEKVLWPAHSVRFLYFWSDVYLGSLGNKNGTDLPLLSNERQS 662
             |.|||.|.:..::.:.:|..:|    |.|:......|.::|.|
Yeast   615 EEEEKVEWISPDLKKVQWWWQLY----GRKDSEMNDELRHKRDS 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3632NP_001096996.1 PH-like 35..147 CDD:302622
Myotub-related 221..590 CDD:284109 127/461 (28%)
FYVE_MTMR4 1162..1221 CDD:277272
YMR1NP_012644.1 PH-like 1..>44 CDD:418428
Myotub-related 152..570 CDD:399535 127/464 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 194 1.000 Domainoid score I610
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46536
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10807
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.