DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3632 and Mtmr10

DIOPT Version :9

Sequence 1:NP_001096996.1 Gene:CG3632 / 32589 FlyBaseID:FBgn0030735 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_001094316.1 Gene:Mtmr10 / 309255 RGDID:1305958 Length:771 Species:Rattus norvegicus


Alignment Length:615 Identity:143/615 - (23%)
Similarity:229/615 - (37%) Gaps:185/615 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GILALSNYRI-FLSKQSTGYETY-----------VPLGLIES-VQVRD----------------- 95
            |.|..||::| |::......:.:           |||..||. |.|.|                 
  Rat    66 GKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKVLGPNQKLKFN 130

  Fly    96 LFQLIVNCKDASTVRCSFPSAEQCSDWQRRIHLMI---GVPESLETLFAFPFYSWTCDVLGS--G 155
            ..:||:.|||...||..|.  |...:..:::.|.|   ..|..|:.||||.:       :|.  .
  Rat   131 PTELIIYCKDFRIVRFRFD--ESGPESAKKVCLAIAHYSQPTDLQLLFAFEY-------VGKKYH 186

  Fly   156 NGSGIVSAQANGNGLIAKDRCLTLHNGLAKPTANVTASNPLPDPASETISAAMSNRLQRSVRYES 220
            |.:..|:..::|.|        .:.:|...|::..|       |..||.               |
  Rat   187 NSANKVNGVSSGGG--------GVWSGAGSPSSQRT-------PLFETY---------------S 221

  Fly   221 DFKNEVARLGFDLKGSWRISTANADFKLCPSYPPKLLVPCCITDEMLHNVANFRGSRRLPAVVWR 285
            |:..|..|.|   ...||:.:.|..:.:....|...:||..:.|:.|...:.....||:|...|.
  Rat   222 DWDRETKRTG---ASGWRVCSINEGYMISTCLPEYFVVPSSLADQDLKIFSPSFVGRRMPCWCWS 283

  Fly   286 HQKSGAILARCSQPEVGWLGWRNTRDEQLLKALADACAFDRGEHARHSTCANAKAQPTKGSKETN 350
            |....|::......:|  |..|.. |:::..|:.                               
  Rat   284 HSNGSALVRMALIKDV--LQQRKI-DQRICNAIT------------------------------- 314

  Fly   351 GQSGLSGKSSPSLDDSSHEELTLDEIKKILIVDARSYTSAVTNRARGGGCECIEYYPCAEIEFMN 415
                   ||.|...|....:|.                                         ..
  Rat   315 -------KSHPQRSDVYKSDLD-----------------------------------------KT 331

  Fly   416 LGNIHAIRKSFHAVRQLCASSP---DDPNWYGQLEKTMWMQHLSGLLGATMTVVHTIEKNGRPVL 477
            |.||..|:.:|..::|||.:.|   .:..|...||.|.|::::...|..:..:|:.:|.....|:
  Rat   332 LPNIQEIQAAFVKLKQLCVNEPFEETEEKWLSSLESTRWLEYVRAFLKHSAELVYILESQRLSVV 396

  Fly   478 VHCSDGWDRTPQIVATAQLCLDPYYRTVEGFRVLVEREWLNFGHKFADRSGNGPNSDEVNERCPV 542
            :...:|.|.:..:.:..|:.:|||:||:.||:.||::||:..|:.|.||..:...|:   :..|:
  Rat   397 LQEEEGRDLSCLVASLVQVMMDPYFRTITGFQSLVQKEWVMAGYPFLDRCNHLKRSE---KESPL 458

  Fly   543 FLQWLDLVHQIHRQYPCSFEFSISYLIKLAQHSLSCLFGTFLCNSLRERIENS---VFDRTF--- 601
            ||.:||...|:..|||.:||||.:||..|...:...||||||.||..:|::.|   ...:..   
  Rat   459 FLLFLDTTWQLLEQYPAAFEFSETYLAVLCDSTRISLFGTFLFNSPHQRVKQSTEFAISKNIQLG 523

  Fly   602 --------SVW----PFLAE--TMYRNPLY 617
                    |||    .|.|:  |::.||.|
  Rat   524 DEKGLKFPSVWDWSLQFTAKDRTLFHNPYY 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3632NP_001096996.1 PH-like 35..147 CDD:302622 31/118 (26%)
Myotub-related 221..590 CDD:284109 89/371 (24%)
FYVE_MTMR4 1162..1221 CDD:277272
Mtmr10NP_001094316.1 PH-GRAM_MTMR10 21..193 CDD:270154 33/135 (24%)
PTPc 222..503 CDD:304379 87/368 (24%)
3-PAP 574..701 CDD:289355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.