DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment f2 and flz

DIOPT Version :9

Sequence 1:XP_005169022.1 Gene:f2 / 325881 ZFINID:ZDB-GENE-030131-4606 Length:635 Species:Danio rerio
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:483 Identity:116/483 - (24%)
Similarity:180/483 - (37%) Gaps:150/483 - (31%)


- Green bases have known domain annotations that are detailed below.


Zfish   178 PDKHKDGPWCFTRDPTVRRETCNVPKCGEAVVPPPKAPTAKPEQRHV--------ISKCLPGNGE 234
            |:|........||.|..||.|     ....|....:.|..|...|.|        :|...|.:.|
  Fly  1322 PNKKTSAVSTTTRKPATRRTT-----VAAKVTTTTRRPATKKPTRRVSSTVKTTTVSSARPADDE 1381

Zfish   235 TYTGELFVTLGLHTCLQWSSAEVQALIKKKELLPQVQLVKNHCRNPDGDMEGPWCYIKAASGNIT 299
            ....|             ...:|                     ||:                  
  Fly  1382 IVDEE-------------DEEDV---------------------NPN------------------ 1394

Zfish   300 IDYCDLELCDAPLDKFVEEG---------GGRE-----RTTLDQRKAFFNPRSFGNGELDCGERP 350
                       |.|..:::|         .||:     ||......||.:|.:      :||.||
  Fly  1395 -----------PSDNEIDQGATLSSYGGANGRKIHSTSRTLPTPNLAFHSPST------ECGVRP 1442

Zfish   351 LFEKINKADKNEKELLMSYTGSRIVGGDEAEVASAPWQVMLYKRSPQELL----CGASLISDEWI 411
                             .....|||||..:...:.||||::.:.:...|.    ||..||:..::
  Fly  1443 -----------------HVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYV 1490

Zfish   412 LTAAHCILYPPWNKNFTINDIIVRLGKHSRT---KYERGIEKIVAIDEIIVHPKYNWKENLNRDI 473
            :|||||      ...| :..::..:|:...:   :.:|.:.|  .:..:|||.:|: ......|:
  Fly  1491 ITAAHC------QPGF-LASLVAVMGEFDISGDLESKRSVTK--NVKRVIVHRQYD-PATFENDL 1545

Zfish   474 ALLHMKKPVVFTSEIHPVCLPTKSIAKNLMFAGYKGRVTGWGNLRESWTSNPTNLPTVLQQIHLP 538
            |||.:..||.|.:.|.|:|:| ..:|.   |.|....|||||.|:..     ..:|:|||::.:|
  Fly  1546 ALLELDSPVQFDTHIVPICMP-NDVAD---FTGRMATVTGWGRLKYG-----GGVPSVLQEVQVP 1601

Zfish   539 IVDQSICR------NSTSVIITDNMFCAGYQPDDSKRGDACEGDSGGPFVMKSPSDNRWYQIGIV 597
            |::.|:|:      .....|:| :..||||.   :.:.|:||||||||.|::.| |.|:...|.|
  Fly  1602 IIENSVCQEMFHTAGHNKKILT-SFLCAGYA---NGQKDSCEGDSGGPLVLQRP-DGRYELAGTV 1661

Zfish   598 SWGEGCDRDGKYGFYTHLFRMRRWMKKV 625
            |.|..|......|.|......:.|::.:
  Fly  1662 SHGIKCAAPYLPGVYMRTTFYKPWLRSI 1689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
f2XP_005169022.1 GLA 39..100 CDD:214503
KR 126..206 CDD:214527 8/27 (30%)
KR 228..309 CDD:214527 6/80 (8%)
Thrombin_light 326..373 CDD:286482 7/46 (15%)
Tryp_SPc 373..621 CDD:214473 81/260 (31%)
Tryp_SPc 374..625 CDD:238113 81/263 (31%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 81/263 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.