DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and MPD1

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_014931.3 Gene:MPD1 / 854462 SGDID:S000005814 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:40/164 - (24%)
Similarity:74/164 - (45%) Gaps:28/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MTSDNIDMTL-ASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKVVLGKVDCD--KE 99
            :|..:.|..: .:|....:.|||.||.....|:..|.:||.::.      |.|.:..|:||  |.
Yeast    34 LTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRLD------GVVQVAAVNCDLNKN 92

  Fly   100 TAIASRFHINKYPTLKIVRNGQ--LSK--------------REYRGQRSAEAFLEFVKKQLEDPI 148
            .|:.:::.:|.:|||.:.|..:  |||              ..|.|.|:....::|...::...:
Yeast    93 KALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEVYSGARTLAPIVDFSLSRIRSYV 157

  Fly   149 QEFKSLKDLENLDSKK-RLILGYFDRRDQ--PEY 179
            ::|..:..|.:|..|. :|.:..|.::|:  |.|
Yeast   158 KKFVRIDTLGSLLRKSPKLSVVLFSKQDKISPVY 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 30/120 (25%)
PDI_b_ERp44 148..241 CDD:239368 9/35 (26%)
Thioredoxin_6 171..357 CDD:290560 4/11 (36%)
PDI_b'_ERp44 252..362 CDD:239370
MPD1NP_014931.3 ER_PDI_fam 30..>275 CDD:273457 40/164 (24%)
PDI_a_MPD1_like 30..150 CDD:239300 31/121 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.