DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and Tmx3

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:XP_038953303.1 Gene:Tmx3 / 682967 RGDID:1592777 Length:470 Species:Rattus norvegicus


Alignment Length:371 Identity:87/371 - (23%)
Similarity:145/371 - (39%) Gaps:98/371 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKVVLGKVDCDKETAIASRFHINKYPTL 114
            :::..::|||.||.....|.||:.|...::|.   ....|.:||:|....::|||.|.:..|||:
  Rat    58 DDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKS---IGSPVKVGKMDATSYSSIASEFGVRGYPTI 119

  Fly   115 KIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQEFKSLKDLENLDSKKRLILGYFDRRDQPEY 179
            |::: |.|: ..|||.|:.:..:||..:.....|:...|.:..:::..:.|:...|.. .:.|  
  Rat   120 KLLK-GDLA-YNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFDHVRKRHRVFFVYIG-GESP-- 179

  Fly   180 DIFRKVATNLKEDCQFHVGFGDAAQAMHPPGTPIIVFRPDVALSHENDETYTGSLQNFDELKIWV 244
                     |||.      :.|||       :.:||:            ||..|          .
  Rat   180 ---------LKEK------YIDAA-------SELIVY------------TYFFS----------A 200

  Fly   245 QEKCVPLVREITFENAEELTEEGLPFLILFHHPT----DHNSIKDYKSIIERQLLDEKQNVNFLT 305
            .|..||          |.:|.:.:|.:::|...|    |.....|..|.|.|:...     |:||
  Rat   201 SEDVVP----------EYVTLKEMPAVLVFKDDTYFVYDEYEDGDLSSWISRERFQ-----NYLT 250

  Fly   306 ADGKRFAHPLHHLGKSEDDLPLIAID----SFKHMYLFPHFSDMYSPGKLKQFLQDL---YSGKL 363
            .||    ..|:.||.:...:.:..||    |.:|.             :||..:|::   :....
  Rat   251 MDG----FLLYELGDTGKLVAIAVIDEKNTSLEHT-------------RLKSIIQEVARDFRDHF 298

  Fly   364 HREFHYGPDPSNDIEPDPHTGKGTSPPESKFKELGPSKHRYTLLEK 409
            ||:|.:|....||........:.|.|   ....|..|..:|.||::
  Rat   299 HRDFQFGHMDGNDYINTLLMDELTVP---TIVVLNTSNQQYFLLDR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 29/89 (33%)
PDI_b_ERp44 148..241 CDD:239368 16/92 (17%)
Thioredoxin_6 171..357 CDD:290560 39/193 (20%)
PDI_b'_ERp44 252..362 CDD:239370 25/120 (21%)
Tmx3XP_038953303.1 PDI_a_TMX3 44..147 CDD:239298 30/93 (32%)
ER_PDI_fam 46..>361 CDD:273457 87/371 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.