DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and zgc:136472

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001035331.1 Gene:zgc:136472 / 678514 ZFINID:ZDB-GENE-060421-2552 Length:510 Species:Danio rerio


Alignment Length:391 Identity:84/391 - (21%)
Similarity:156/391 - (39%) Gaps:52/391 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CVALVAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWC--RFSNILAPIFAEAA 76
            |:.|...|...|.....:....:.:|..|....|..:|.:.::|||...  ...:||.  |.|||
Zfish    12 CLFLHQTLAESQSNSIVEDKDVLVLTKSNFHRALKQHEQLLVHFYAPLSGQSLGSILE--FREAA 74

  Fly    77 DKIKEEFPEAGKVVLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREY-RGQRSAEAFLEFV 140
            ..:||...:   |.||.||..||..:|...:|...|::::..:|..:...| ...:|:.:.|.::
Zfish    75 GALKEADSD---VKLGGVDVKKEKELAESLNITTLPSIRLYLSGDKNNPVYCPVLKSSASILTWL 136

  Fly   141 KKQLEDPIQEFKSLKDLEN-LDSKKRLILGYFDRRDQPEYDIFRKVATNLKEDCQFHVGFGDAAQ 204
            |::.........::..||| |...:.::|..|...::....:|.:.|.::.:     :.||  ..
Zfish   137 KRRAGPSADIISNVTQLENFLRRDELVVLALFKDLEEGAVKVFYETAADVAD-----LPFG--VT 194

  Fly   205 AMHPPGTPIIVFRPDVALSHEN---------DETYTGSLQNFDELKIWVQEKCVPLVREITFENA 260
            ..|...:...:.|..|.|..::         ..|....|.:|  ::::..|    ||.|.....|
Zfish   195 RHHEVFSKFEISRDSVLLIRKSKLDQQFEMESSTVKTDLVHF--IRLYEME----LVTEYNGVTA 253

  Fly   261 EE-LTEEGLPFLILFHHPTD------HNSIKDYKSIIERQLLDEKQNVNFLTADGK--RFAHPLH 316
            .: |....|..|:||...|:      :|:   |::..||    .:..|.|:..|..  |....:.
Zfish   254 SKILNSVILNHLLLFISKTEGGFEEIYNA---YETTAER----FRGKVLFVLIDVSELRNGRMME 311

  Fly   317 HLGKSEDDLPLIAIDSFKH--MYLFPHFSDMYSPGKLKQFLQDLYSGKLHREFHYGPDPSN-DIE 378
            :.....::.|.:.:.:..:  .|..|  ||.:....|.:|..:...||:..:....|.|:| |.:
Zfish   312 YFHVRSEEAPQVRMVNLSNNLQYQLP--SDQFDTHTLMEFCLNYLDGKVKPKMQSEPVPANWDTQ 374

  Fly   379 P 379
            |
Zfish   375 P 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 29/109 (27%)
PDI_b_ERp44 148..241 CDD:239368 17/102 (17%)
Thioredoxin_6 171..357 CDD:290560 38/205 (19%)
PDI_b'_ERp44 252..362 CDD:239370 24/120 (20%)
zgc:136472NP_001035331.1 ER_PDI_fam 31..478 CDD:273457 80/372 (22%)
PDI_a_family 34..122 CDD:239259 26/92 (28%)
PDI_b_family 147..240 CDD:239279 17/101 (17%)
PDI_b'_family 252..354 CDD:239280 22/110 (20%)
PDI_a_PDI_a'_C 375..477 CDD:239293 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.