DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and PDIA2

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_006840.2 Gene:PDIA2 / 64714 HGNCID:14180 Length:525 Species:Homo sapiens


Alignment Length:531 Identity:101/531 - (19%)
Similarity:176/531 - (33%) Gaps:200/531 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKVVLGKVDCDK 98
            |.:.::...:.:.|..:..:.:.|||.||.....|||.:::||..:.   .|:..|.|.|||...
Human    43 GILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLA---AESMVVTLAKVDGPA 104

  Fly    99 ETAIASRFHINKYPTLKIVRNG-QLSKREYRGQRSAEAFLEFVKK-------QLEDP-------- 147
            :..:|..|.:.:|||||..||| :....||.|.|.||...|::::       :|||.        
Human   105 QRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIG 169

  Fly   148 ------IQEFKSLKDLE----------------NLDSKKRLILGY---------FDRRDQ--PEY 179
                  |..|:.|:|.:                .|..:.||...:         |.:.|:  .::
Human   170 GRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADF 234

  Fly   180 DIFRKVATNLKEDCQFHV-------------------------------------------GFGD 201
            .:..::..:|.:..:|.|                                           |||:
Human   235 PVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGE 299

  Fly   202 AAQAMHPPGTPIIVFRPDVALSHENDETYTGSLQNFDELKIWVQEKCVPLVREITFENAEELTE- 265
            ||.........::|   |||..:|:...|.|           ::.:..|.:|.:..|..::... 
Human   300 AAPRFRGQVLFVVV---DVAADNEHVLQYFG-----------LKAEAAPTLRLVNLETTKKYAPV 350

  Fly   266 EGLPF----LILFHHPTDHNSIKDY---------------KSII----ERQLLDEKQNVNFLTAD 307
            :|.|.    :..|.|...:..:|.|               |:::    |:...||.:|| |:   
Human   351 DGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNV-FV--- 411

  Fly   308 GKRFAHP--------------------------LHHLGKSEDDLPLIAIDSFKHMYLFPHFSDMY 346
              :|..|                          :..|..:.::|...|:..|..:..||     .
Human   412 --KFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFP-----A 469

  Fly   347 SPGK----------LKQFLQDLYSGKLHREFHYGPDPSNDIEPDPHTGKGTSPPESKFKELGPSK 401
            .||:          |:.|.:.|.:|        |..|:.:            |||..........
Human   470 GPGRKVIEYKSTRDLETFSKFLDNG--------GVLPTEE------------PPEEPAAPFPEPP 514

  Fly   402 HRYTLLEKDEL 412
            ...|:..|:||
Human   515 ANSTMGSKEEL 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 35/106 (33%)
PDI_b_ERp44 148..241 CDD:239368 24/162 (15%)
Thioredoxin_6 171..357 CDD:290560 45/290 (16%)
PDI_b'_ERp44 252..362 CDD:239370 28/169 (17%)
PDIA2NP_006840.2 ER_PDI_fam 42..497 CDD:273457 93/489 (19%)
Thioredoxin_like 62..151 CDD:294274 33/91 (36%)
PDI_b_family 157..254 CDD:239279 15/96 (16%)
PDI_b'_family 259..368 CDD:239280 19/122 (16%)
PDI_a_PDI_a'_C 389..491 CDD:239293 19/112 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 492..525 8/52 (15%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 522..525 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.