DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and TXNDC16

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_065835.2 Gene:TXNDC16 / 57544 HGNCID:19965 Length:825 Species:Homo sapiens


Alignment Length:294 Identity:60/294 - (20%)
Similarity:117/294 - (39%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKVVLGKVDCDKET 100
            |.:|.:..:.|:.:::.:.| |||.|...|......:.:.|.|:|    ....::|.:::|...:
Human   394 VELTEETFNATVMASDSIVL-FYAGWQAVSMAFLQSYIDVAVKLK----GTSTMLLTRINCADWS 453

  Fly   101 AIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVK-KQLEDPI--------QEFKS--- 153
            .:.::.::.::|.:|:.:.|: :...|.|....|..|:|:: .::..|:        :|:.|   
Human   454 DVCTKQNVTEFPIIKMYKKGE-NPVSYAGMLGTEDLLKFIQLNRISYPVNITSIQEAEEYLSGEL 517

  Fly   154 LKDLENLDSKKRLILGYFDRRDQPEYDIFRKVATNLK----------ED-----CQFHVGFGDAA 203
            .|||....|..  :||.|....:...:.|.:....||          ||     .::........
Human   518 YKDLILYSSVS--VLGLFSPTMKTAKEDFSEAGNYLKGYVITGIYSEEDVLLLSTKYAASLPALL 580

  Fly   204 QAMHPPGTPIIVFRPDVALSHEND--ETYTGSLQNFDELKIWVQEKCVPLVREITFENAEELTEE 266
            .|.|..|.   :....:|.:|..|  :..|.:|              :.:..|||.||.......
Human   581 LARHTEGK---IESIPLASTHAQDIVQIITDAL--------------LEMFPEITVENLPSYFRL 628

  Fly   267 GLPFLILFHHPTDHNSIKDYK----SIIERQLLD 296
            ..|.||||   :|......||    ::::::.||
Human   629 QKPLLILF---SDGTVNPQYKKAILTLVKQKYLD 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 21/103 (20%)
PDI_b_ERp44 148..241 CDD:239368 22/120 (18%)
Thioredoxin_6 171..357 CDD:290560 29/147 (20%)
PDI_b'_ERp44 252..362 CDD:239370 15/49 (31%)
TXNDC16NP_065835.2 PDI_a_family 394..492 CDD:239259 21/103 (20%)
Thioredoxin_6 533..722 CDD:290560 29/147 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..787
Mediates endoplasmic reticulum retention. /evidence=ECO:0000269|PubMed:25122923 816..819
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.