DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and DNAJC10

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_061854.1 Gene:DNAJC10 / 54431 HGNCID:24637 Length:793 Species:Homo sapiens


Alignment Length:393 Identity:85/393 - (21%)
Similarity:141/393 - (35%) Gaps:119/393 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKVVLGKVDCDKETAIASRFHI 108
            |..:.|.||.|:|||:..|...:.|||.:.:.|.::.      |.:.:|.|:|..:..:.....:
Human   140 DAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEVD------GLLRIGAVNCGDDRMLCRMKGV 198

  Fly   109 NKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQEF------KSL------------- 154
            |.||:|.|.|:| ::..:|.|.||.|:.:.|..:.:...:.|.      .|:             
Human   199 NSYPSLFIFRSG-MAPVKYHGDRSKESLVSFA
MQHVRSTVTELWTGNFVNSIQTAFAAGIGWLIT 262

  Fly   155 ---KDLENLDSKKRLIL----------GYFDRRDQPEYDIFRKVATNLKEDCQFHVGFGDAAQAM 206
               |..:.|.|:.||.|          |:.|...|          .||   |: .:....:..|.
Human   263 FCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQ----------DNL---CK-SLDITTSTTAY 313

  Fly   207 HPPGTPI-------IVFRPDVALSHENDETYTGSLQNFDELKIWVQEKCVPLVREITFENAEELT 264
            .|||..:       |:|    ..|.:..|.|...:.|..:.:         |:...|.|  :.|.
Human   314 FPPGATLNNKEKNSILF----LNSLDAKEIYLEVIHNLPDFE---------LLSANTLE--DRLA 363

  Fly   265 EEGLPFLILFHHPTDHNS----IKDYKSIIERQLLDEKQNVNFLTADGKRFAHPLHHLGKSEDDL 325
            ..  .:|:.||...:.||    :|..|::::..                       |:.....|.
Human   364 HH--RWLLFFHFGKNENSNDPELKKLKTLLKND-----------------------HIQVGRFDC 403

  Fly   326 PLIAIDSFKHMYLF-PHFSDMYSPGKL-------KQFLQDLYS-GKLHREFH---YGPD--PSND 376
            . .|.|...::|:| |..:.....|..       |:.|.|:.: .|.....|   .||.  |:||
Human   404 S-SAPDICSNLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPAND 467

  Fly   377 IEP 379
            .||
Human   468 KEP 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 29/95 (31%)
PDI_b_ERp44 148..241 CDD:239368 24/131 (18%)
Thioredoxin_6 171..357 CDD:290560 36/204 (18%)
PDI_b'_ERp44 252..362 CDD:239370 21/122 (17%)
DNAJC10NP_061854.1 DnaJ 34..>132 CDD:223560
PDI_a_ERdj5_N 129..229 CDD:239301 29/95 (31%)
Trxb 1 235..350 24/132 (18%)
Trxb 2 348..463 26/151 (17%)
PDI_a_ERdj5_C 453..550 CDD:239302 8/18 (44%)
PDI_a_ERdj5_C 556..663 CDD:239302
PDI_a_ERdj5_C 670..775 CDD:239302
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 790..793
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.