DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and TXNDC11

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:XP_011520817.1 Gene:TXNDC11 / 51061 HGNCID:28030 Length:998 Species:Homo sapiens


Alignment Length:163 Identity:37/163 - (22%)
Similarity:70/163 - (42%) Gaps:15/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKVVLGKVDC-DKETAIAS 104
            |..:.....:|:|.|.|||.||..|........:||.::.::      |:...::| ..:.....
Human   116 DYAEYVRRDSEVVLLFFYAPWCGQSIAARAEIEQAASRLSDQ------VLFVAINCWWNQGKCRK 174

  Fly   105 RFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQEFKSLKD-LENLDSKKRLIL 168
            :.|...:|.:.:... .....||:|..||....:||::.:: |:....|..: |:.|.:.:..:|
Human   175 QKHFFYFPVIYLYHR-SFGPIEYKGPMSAVYIEKFV
RRVMK-PLLYIPSQSELLDFLSNYEPGVL 237

  Fly   169 GYFDRRDQPE----YDIFRKVATNLKE-DCQFH 196
            |||:....|:    ...|.....:||: :..||
Human   238 GYFEFSGSPQPPGYLTFFTSALHSLKKVETGFH 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 21/99 (21%)
PDI_b_ERp44 148..241 CDD:239368 13/55 (24%)
Thioredoxin_6 171..357 CDD:290560 7/31 (23%)
PDI_b'_ERp44 252..362 CDD:239370
TXNDC11XP_011520817.1 PDI_a_EFP1_N 97..209 CDD:239304 21/99 (21%)
PDI_a_PDI_a'_C 705..807 CDD:239293
RILP-like <843..928 CDD:304877
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.