DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and tmx4

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001034826.1 Gene:tmx4 / 496882 XenbaseID:XB-GENE-992676 Length:366 Species:Xenopus tropicalis


Alignment Length:343 Identity:79/343 - (23%)
Similarity:123/343 - (35%) Gaps:103/343 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GARIGIGKLGPCVALVAILQLLQYTQPADAAGAV------PMTSDNIDMTLASNELVFLNFYAEW 61
            ||.:......|..|.:.::.::.:. |.:..||.      .:||.|....|....::  .|||.|
 Frog    10 GAMVERTPAAPSRAALLLIAVVLWV-PGECRGAQAESGVRAVTSTNWSALLEGEWMI--KFYAPW 71

  Fly    62 CRFSNILAPIFAEAADKIK---EEFPE---AGKVVLGKVDCDKETAIASRFHINKYPTLKIVRNG 120
            |           .|..:|:   |.|.|   |..|.:||||..:|..::.||.:...||:...::|
 Frog    72 C-----------PACQQIQSAWESFAERSHALGVKVGKVDVTEEPGLSGRFFVTTLPTIFHAKDG 125

  Fly   121 QLSKREYRGQRSAEAFLEFV---KKQLEDPIQEFKS--------LKDLENLDSKKRLILGYFDRR 174
            ..  |.|.|.|..|....|:   |.::.:|:..::|        :..|..|....|.:..||   
 Frog   126 VF--RRYHGSRMVEDLQTFISEKKWEVIEPVAGWRSPSSILMSGMASLFQLSGWMRQLHNYF--- 185

  Fly   175 DQP-------EYDIFRKVAT-----------NLKEDCQFHVGFGDAAQAMHPPGTPIIVFRPDVA 221
            ..|       .|.|| .|||           .|..||            ..|......|.|.:| 
 Frog   186 TGPLGIPAWGSYVIF-VVATLFIGLLLGLILVLIVDC------------FCPSKAKYEVIREEV- 236

  Fly   222 LSHENDETYTGSLQNFDELKIWVQEKCVPLVREITFENAEELTEEGLPFLILFHHPTDHNSIKDY 286
                |:|         |...:....|.:|:.:|.  :||  ..|||          :|:::.::.
 Frog   237 ----NEE---------DLANVEADPKVLPMEKEA--DNA--ANEEG----------SDNDNEEEN 274

  Fly   287 KSIIERQLLD--EKQNVN 302
            ...|.....|  ||:|.|
 Frog   275 GEEISNSSEDDSEKENSN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 33/118 (28%)
PDI_b_ERp44 148..241 CDD:239368 23/118 (19%)
Thioredoxin_6 171..357 CDD:290560 33/152 (22%)
PDI_b'_ERp44 252..362 CDD:239370 13/53 (25%)
tmx4NP_001034826.1 PDI_a_TMX 45..145 CDD:239292 32/114 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.