DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERp44 and CG10029

DIOPT Version :10

Sequence 1:NP_573111.1 Gene:ERp44 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_649716.1 Gene:CG10029 / 40883 FlyBaseID:FBgn0037498 Length:410 Species:Drosophila melanogaster


Alignment Length:73 Identity:22/73 - (30%)
Similarity:31/73 - (42%) Gaps:20/73 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 NHTYYVLVVSRAKDRNMDKFNKIDLIFRFASVILYPTLTITLLLQLRTIKKKRQNMNKNALNDQS 270
            :|:.|.|||.           .:.||| |||      ||..|:|.|..|........:|:..|| 
  Fly    12 DHSIYGLVVF-----------LVILIF-FAS------LTTGLILCLLKIWCTFHEQRRNSTFDQ- 57

  Fly   271 YKTNKMIL 278
             :|.:.|:
  Fly    58 -RTRRSIV 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERp44NP_573111.1 PDI_a_ERp44 33..140 CDD:239294
PDI_b_ERp44 148..241 CDD:239368 11/34 (32%)
PDI_b'_ERp44 252..362 CDD:239370 6/27 (22%)
CG10029NP_649716.1 PDI_a_ERp44 27..134 CDD:239294 15/47 (32%)
PDI_b_ERp44 142..237 CDD:239368
PDI_b'_ERp44 248..357 CDD:239370
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.