DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and ERp60

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster


Alignment Length:400 Identity:98/400 - (24%)
Similarity:180/400 - (45%) Gaps:47/400 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ADAAGA----VPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKVV 90
            |.::||    :.:..|:...||..:|...:.|||.||.....|.|.:|:||:.:|::.|   .:.
  Fly    15 AISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDP---PIK 76

  Fly    91 LGKVDC---DKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQEFK 152
            |.||||   .|||  .|::.::.||||||.|..::| ::|.|.|.|....::::.|:....:..:
  Fly    77 LAKVDCTEAGKET--CSKYSVSGYPTLKIFRQDEVS-QDYNGPREASGIAKYMRAQVGPASKTVR 138

  Fly   153 SLKDLEN-LDSKKRLILGYFDRRDQPEYDIFRKVATNLKEDCQFHVGFGDAAQAMHPPGTP---I 213
            ::.:|:. ||:|...:.|||...|.....||.|.|...:|..:|  |.....:.:...|..   :
  Fly   139 TVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRF--GHSSEKEVLDKQGETDKIV 201

  Fly   214 IVFRPDVALSHENDE-TYTGSLQNFDELKIWVQEKCVPLVREITFENAEELTEEGLPFLILFH-- 275
            ::..|.::...|:.. .:.||.::  :|..:|:|....||...|.::.::...   |.:..::  
  Fly   202 LIRAPHLSNKFESSSIKFEGSSES--DLSTFVKENFHGLVGHRTQDSVKDFQN---PLITAYYSV 261

  Fly   276 ----HPTDHNSIKDYKSIIERQLLDEKQNVNFLTADGKRFAHPLHHLGKS-EDDLPLIAIDSFKH 335
                :|...|..::....:.::.:.:   :||..|....|.|.|:..|.. ..|.|::.....|:
  Fly   262 DYQKNPKGTNYWRNRVLKVAKEFVGQ---INFAIASKDDFQHELNEYGYDFVGDKPVVLARDEKN 323

  Fly   336 M-YLFPHFSDMYSPGKLKQFLQDLYSGKLHREFHYGPDP-SNDIEPDPHTGKGTSPPESKFKELG 398
            : |.   ..|.:|...|:.|::.|.:.:|.......|.| |||........|       .|.:|.
  Fly   324 LKYA---LKDEFSVENLQDFVEKLLANELEPYIKSEPIPESNDAPVKVAVAK-------NFDDLV 378

  Fly   399 PSKHRYTLLE 408
            .:..:.||:|
  Fly   379 INNGKDTLIE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 39/113 (35%)
PDI_b_ERp44 148..241 CDD:239368 20/97 (21%)
Thioredoxin_6 171..357 CDD:290560 38/197 (19%)
PDI_b'_ERp44 252..362 CDD:239370 21/117 (18%)
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 94/391 (24%)
PDI_a_PDIR 23..126 CDD:239295 37/108 (34%)
PDI_b_ERp57 133..235 CDD:239367 23/105 (22%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 20/114 (18%)
PDI_a_PDI_a'_C 365..467 CDD:239293 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463717
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.