DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and Txndc16

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:XP_038949711.1 Gene:Txndc16 / 361025 RGDID:1306755 Length:854 Species:Rattus norvegicus


Alignment Length:282 Identity:62/282 - (21%)
Similarity:117/282 - (41%) Gaps:36/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VPMTSDNIDMT-LASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKVVLGKVDCDKE 99
            |.:|.:..:.| :||:.||.  |||.|...|......:.:.|.|:|..    ..::|.:::|...
  Rat   429 VELTEETFNTTVMASDTLVL--FYATWHAVSMAFLQSYTDVAVKLKGR----STILLTRINCADW 487

  Fly   100 TAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVK-KQLEDP-----IQEFKS----- 153
            :.:.::.::..:|.:|:.:.|: |...|.|...::..|.|:: .::..|     |||.:.     
  Rat   488 SDVCTKQNVTAFPMVKLYKEGE-SPVSYAGMLGSKDLLTFI
QLNKISSPVNIASIQEAEKYLRGE 551

  Fly   154 -LKDLENLDSKKRLILGYFDRRDQPEYDIFRKVATNLKEDCQFHVGFGDAAQAMHPPGTPIIVFR 217
             .|||.:..|..  :||.|........:.|:|....|:......|...|.|..:   ........
  Rat   552 LYKDLFSFSSVS--VLGLFTPAMTSAKECFQKAGKQLRGSVLTGVYSEDDAWIL---SNKYATTL 611

  Fly   218 PDVALSHENDETYTGSLQNFDELKIWVQEKCVPLVREITFENAEELTEEGLPFLILFHHP----- 277
            |.:.|:...:    |.:::.......||: .|.::.....|...|:|.|.||..:.|..|     
  Rat   612 PALLLARPKE----GRIESVPLDTTPVQD-MVQILANAPLEAFPEITVENLPTYLRFQRPLLILF 671

  Fly   278 TDHNSIKDYKSIIERQLLDEKQ 299
            :|.:....|::|: ..|:.:||
  Rat   672 SDGSINPQYRNIV-LALVRQKQ 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 24/104 (23%)
PDI_b_ERp44 148..241 CDD:239368 19/98 (19%)
Thioredoxin_6 171..357 CDD:290560 27/134 (20%)
PDI_b'_ERp44 252..362 CDD:239370 14/53 (26%)
Txndc16XP_038949711.1 ER_PDI_fam <173..527 CDD:273457 24/104 (23%)
PDI_a_family 429..527 CDD:239259 24/104 (23%)
Thioredoxin_6 568..757 CDD:404691 27/134 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.