DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and Pdia5

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001014147.1 Gene:Pdia5 / 360722 RGDID:1359236 Length:517 Species:Rattus norvegicus


Alignment Length:180 Identity:46/180 - (25%)
Similarity:80/180 - (44%) Gaps:37/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILQLLQYTQP----------ADAAGAV-PMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFA 73
            |::.|:..||          ||..|:| .:|.::.|..:..:..|.:.|:|.||.....:.|.|.
  Rat   250 IVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFE 314

  Fly    74 EAADKIKEEFPEAGKVVLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLE 138
            .||:.:..:...:|  ||..||.....|:|.||||:.:||||..:||:  ::.....|:.:.|:|
  Rat   315 SAAEVLHGDAESSG--VLAAVDATINEALAERFHISAFPTLKYFKNGE--QQAVPALRTKKKFIE 375

  Fly   139 FVKKQLEDPIQE-----------------FKSLKDLENLDSKKRLILGYF 171
            :::.....|..|                 |:     |.|..||..::.::
  Rat   376 WMQNPEAPPPPEPTWEEQQTSVLHLVGDNFR-----ETLKKKKHTLVMFY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 33/107 (31%)
PDI_b_ERp44 148..241 CDD:239368 6/41 (15%)
Thioredoxin_6 171..357 CDD:290560 0/1 (0%)
PDI_b'_ERp44 252..362 CDD:239370
Pdia5NP_001014147.1 PDI_b_PDIR_N 26..137 CDD:239365
PDI_a_PDIR 150..254 CDD:239295 1/3 (33%)
ER_PDI_fam 166..501 CDD:273457 46/180 (26%)
PDI_a_PDIR 275..377 CDD:239295 32/105 (30%)
PDI_a_PDIR 396..499 CDD:239295 5/30 (17%)
Prevents secretion from ER. /evidence=ECO:0000255 514..517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.