DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and CaBP1

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster


Alignment Length:469 Identity:106/469 - (22%)
Similarity:172/469 - (36%) Gaps:137/469 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YTQPADAAGAVPMTSDNIDMTLASNELVF-LNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKV 89
            :..|:|  |.|.:|..|.|..:..::.:: :.|||.||.....|.|.:.:.|..:|      |.|
  Fly    20 FYSPSD--GVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALK------GVV 76

  Fly    90 VLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRS----AEAFLEFVKKQLE----- 145
            .:|.|:.|.::.::.:|.:..:||:||....:.|..:|.|||:    |||.|..|||:::     
  Fly    77 KVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQGVLGG 141

  Fly   146 --------------DPIQEFKSLKDLENLDSKKRLILGYFD--------------RRDQPEYDIF 182
                          |.:.|...    :|.|   :|:|...|              :...||:   
  Fly   142 GGGSSSGGSGSSSGDDVIELTE----DNFD---KLVLNSDDIWLVEFFAPWCGHCKNLAPEW--- 196

  Fly   183 RKVATNLKEDCQFHVGFGDA------AQAMHPPGTPIIVFRPDVALSHENDETYTGSLQNFDELK 241
            .|.|..||.  :..:|..||      |...:..|.|.|.|.|..:....:.:.|.|. :...::.
  Fly   197 AKAAKELKG--KVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGG-RTASDIV 258

  Fly   242 IWVQEK---------CVPLVREITFENAEELTEEGLPFLILFHHPTDHNSIKDYKSIIERQLLDE 297
            .|..:|         .:.::.|.|||.|    .||.|..::...|                    
  Fly   259 SWASDKHVANVPAPELIEIINESTFETA----CEGKPLCVVSVLP-------------------- 299

  Fly   298 KQNVNFLTADGK---RFAHPLHHLGKS-------------------EDDL-------PLIAIDSF 333
                :.|..|.|   :|...|..||:.                   |:.|       |.:|:.:|
  Fly   300 ----HILDCDAKCRNKFLDTLRTLGEKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNF 360

  Fly   334 KHMYLFPHFSDMYSPGKLKQFLQDLYSGKLHREFHYGPDPSNDIEPDPHTGKGTSPPESKFKELG 398
            |.| .|......:|...:.:||:|:..|:.|.....|......:..||..||....|..:..:|.
  Fly   361 KKM-KFSVLKGSFSKDGINEFLRDISYGRGHTAPVRGAKKPAIVSVDPWDGKDGQLPTEEDIDLS 424

  Fly   399 PSKHRYTLLEKDEL 412
            ...     |:||||
  Fly   425 DID-----LDKDEL 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 33/111 (30%)
PDI_b_ERp44 148..241 CDD:239368 23/112 (21%)
Thioredoxin_6 171..357 CDD:290560 47/243 (19%)
PDI_b'_ERp44 252..362 CDD:239370 28/138 (20%)
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 28/98 (29%)
PDI_a_P5 157..262 CDD:239299 24/117 (21%)
Thioredoxin_6 190..383 CDD:290560 46/227 (20%)
P5_C 271..400 CDD:239281 31/157 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.