DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and CG9302

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster


Alignment Length:182 Identity:48/182 - (26%)
Similarity:81/182 - (44%) Gaps:35/182 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKV--VLGKVDCDK 98
            |.:||...:..|...:...:.|||.||.....:.|.:.:||.::|::     |:  :|..:|..|
  Fly   274 VHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQK-----KIPGLLAALDATK 333

  Fly    99 ETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDP--------IQEFKSLK 155
            |.:||.::.:..|||:|...|| :.|.|. ..|.|...:||::...|.|        .:|.:..|
  Fly   334 EPSIAEKYKVKGYPTVKFFSNG-VFKFEV-NVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDSK 396

  Fly   156 DLENLD----------SKKRLILGYFD-----RRDQPEYDIFRKVATNLKED 192
            ::..||          .|..|::.|..     :..:||   |...||.|::|
  Fly   397 EVLFLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKPE---FTAAATALQDD 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 31/105 (30%)
PDI_b_ERp44 148..241 CDD:239368 14/60 (23%)
Thioredoxin_6 171..357 CDD:290560 7/27 (26%)
PDI_b'_ERp44 252..362 CDD:239370
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
ER_PDI_fam 166..500 CDD:273457 48/182 (26%)
PDI_a_PDIR 272..373 CDD:239295 31/105 (30%)
PDI_a_PDIR 397..498 CDD:239295 12/52 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.