DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and prtp

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster


Alignment Length:313 Identity:73/313 - (23%)
Similarity:126/313 - (40%) Gaps:76/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKVVL 91
            |...|....|.:..:..|..:|... ||:.|:|.||.....:.|::.:.|:.:..:.|   ||::
  Fly    31 TGKQDKQFTVELDPETFDTAIAGGN-VFVKFFAPWCGHCKRIQPLWEQLAEIMNVDNP---KVII 91

  Fly    92 GKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQ----EFK 152
            .||||.|...:.:...:..||||::.:.|:....:::|.|...|..:|:.|:|..|.:    |.|
  Fly    92 AKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPAEADLGEVK 156

  Fly   153 SLKDLENLDSKKRLIL------------GYFDR----------RDQPEYDIFRK------VATNL 189
            . :.:|||:..|.:.|            .:|.:          |..|.::...|      ..|..
  Fly   157 R-EQVENLNIGKVVDLTEDTFAKHVSTGNHFVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTIS 220

  Fly   190 KEDCQFHVGFGDAAQAMHPPGTPIIVFRPDVALSHENDETYTGSLQNFDELKIWVQEKC-VPL-- 251
            |.||   ..|....|.....|.|.:::..|    .:..|.|:|: ::...||.:|::.. |||  
  Fly   221 KIDC---TQFRSICQDFEVKGYPTLLWIED----GKKIEKYSGA-RDLSTLKTYVEKMVGVPLEK 277

  Fly   252 -----------VREITFEN--AEELT--------------EEGLPFLILFHHP 277
                       :.|:..|.  |::||              .||:.| |.|:.|
  Fly   278 TAGEAGDEKVVIEEVAGEEDAAKKLTPQQLTGEDEFDQAIAEGVAF-IKFYAP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 27/106 (25%)
PDI_b_ERp44 148..241 CDD:239368 23/124 (19%)
Thioredoxin_6 171..357 CDD:290560 33/153 (22%)
PDI_b'_ERp44 252..362 CDD:239370 11/42 (26%)
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 27/105 (26%)
ER_PDI_fam 39..409 CDD:273457 71/305 (23%)
PDI_a_ERp46 167..267 CDD:239303 20/107 (19%)
PDI_a_ERp46 303..407 CDD:239303 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.