DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and Erp27

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001100095.1 Gene:Erp27 / 297698 RGDID:1565381 Length:272 Species:Rattus norvegicus


Alignment Length:225 Identity:51/225 - (22%)
Similarity:86/225 - (38%) Gaps:50/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 AEAFLEFVKKQLEDPIQEFKSLKDL----ENLDSKKRLILGYFDRRDQPEYDIFRKVATNLKEDC 193
            |.|.:|...:.|..| :|.:.|.|:    |.:.:.:..::|:|...:.|...|||.:|...::  
  Rat    23 ATADVEETSEGLGTP-REPRWLTDIPATVELIAAAEVAVIGFFQDLEIPIVSIFRSMAQQFQD-- 84

  Fly   194 QFHVGFG-----DAAQAMHPPGTPIIVFR----PDVALSHEN-DETYTGSLQNFDELK--IWVQE 246
               |.||     :.....:.....|.:||    ..:.|..|: |:.....|..|..|.  .||.|
  Rat    85 ---VSFGISNHSEVLTHYNVTSNSICLFRLVDNKQLRLDAEDIDDLDAAKLSRFIHLNNLHWVTE 146

  Fly   247 KCVPLVREITFENAEELTEEGLPFLILFHHPTDHNSIKDYK---SIIERQLLDEKQNVNFLTAD- 307
            .. |::....|..   :.:..|..::....|....|::.|:   .:.:.|:|       |:..| 
  Rat   147 YS-PMIGAGLFNT---MVQTHLLLIMNKASPEYEESLRSYQKAAKLFQGQIL-------FVLVDS 200

  Fly   308 GKRFAHPLHHLGK-------SEDDLPLIAI 330
            |||      ..||       .|..||.:||
  Rat   201 GKR------ENGKVIAYFRLKESQLPALAI 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 3/6 (50%)
PDI_b_ERp44 148..241 CDD:239368 22/106 (21%)
Thioredoxin_6 171..357 CDD:290560 41/183 (22%)
PDI_b'_ERp44 252..362 CDD:239370 19/90 (21%)
Erp27NP_001100095.1 PDI_b_family 43..139 CDD:239279 21/100 (21%)
Thioredoxin_6 64..250 CDD:290560 41/183 (22%)
PDI_b'_family 156..253 CDD:239280 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.