DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and Tmx4

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001093999.1 Gene:Tmx4 / 296182 RGDID:1305146 Length:336 Species:Rattus norvegicus


Alignment Length:137 Identity:39/137 - (28%)
Similarity:58/137 - (42%) Gaps:18/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAG 87
            |.|...||:.:...|||:.|  .||.......|.|||.||.        ..:..|...|.|.:.|
  Rat    25 LEQAALPAEESRVQPMTASN--WTLVMEGEWMLKFYAPWCP--------SCQQTDSEWETFAKNG 79

  Fly    88 ---KVVLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFV---KKQLED 146
               ::.:||||..:|..::.||.:...|.....::|..  |.|||....|....::   |.|..:
  Rat    80 ETLQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIF--RRYRGPGIYEDLQNYILEKKWQSVE 142

  Fly   147 PIQEFKS 153
            |:..:||
  Rat   143 PLTGWKS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 30/109 (28%)
PDI_b_ERp44 148..241 CDD:239368 2/6 (33%)
Thioredoxin_6 171..357 CDD:290560
PDI_b'_ERp44 252..362 CDD:239370
Tmx4NP_001093999.1 Thioredoxin_like 35..135 CDD:294274 30/111 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.