DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9911 and Txndc5

DIOPT Version :9

Sequence 1:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_663342.3 Gene:Txndc5 / 105245 MGIID:2145316 Length:417 Species:Mus musculus


Alignment Length:122 Identity:39/122 - (31%)
Similarity:63/122 - (51%) Gaps:6/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QPADAAGAV-PMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKVVL 91
            :|....|.| .:|..:.:.|:|.. :.|:.|||.||.....|||.:.|.:   |:|||....|.:
Mouse   301 EPTGDKGTVLALTEKSFEDTIAQG-ITFVKFYAPWCGHCKNLAPTWEELS---KKEFPGLSDVTI 361

  Fly    92 GKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPI 148
            .:|||..|..:.|::.:..||||.:.|.|: ...|:.|.|..::...||.:|.:|.:
Mouse   362 AEVDCTAERNVCSKYSVRGYPTLLLFRGGE-KVGEHNGGRDLDSLHSFVLRQAKDEL 417

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 34/107 (32%)
PDI_b_ERp44 148..241 CDD:239368 0/1 (0%)
Thioredoxin_6 171..357 CDD:290560
PDI_b'_ERp44 252..362 CDD:239370
Txndc5NP_663342.3 PDI_a_ERp46 47..150 CDD:239303
ER_PDI_fam 52..417 CDD:273457 39/120 (33%)
PDI_a_ERp46 176..276 CDD:239303