DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and ZRANB2

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_976225.1 Gene:ZRANB2 / 9406 HGNCID:13058 Length:330 Species:Homo sapiens


Alignment Length:66 Identity:21/66 - (31%)
Similarity:31/66 - (46%) Gaps:23/66 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 DWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNR 342
            ||:|.:|:|.|:|.|:|||.|.|||                       |.:..:|...|||::.|
Human    68 DWQCKTCSNVNWARRSECNMCNTPK-----------------------YAKLEERTGYGGGFNER 109

  Fly   343 D 343
            :
Human   110 E 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796
RRM_SARFH 122..204 CDD:240978
zf-RanBP 275..304 CDD:279035 15/25 (60%)
RanBP2-type Zn finger 279..298 CDD:275375 10/18 (56%)
ZRANB2NP_976225.1 ZnF_RBZ 11..35 CDD:197784
RanBP2-type Zn finger 13..34 CDD:275376
ZnF_RBZ 67..91 CDD:197784 12/22 (55%)
RanBP2-type Zn finger 69..88 CDD:275376 10/18 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..330
Required for nuclear targeting 151..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.