powered by:
Protein Alignment caz and ZRANB2
DIOPT Version :9
Sequence 1: | NP_523365.2 |
Gene: | caz / 32587 |
FlyBaseID: | FBgn0285954 |
Length: | 399 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_976225.1 |
Gene: | ZRANB2 / 9406 |
HGNCID: | 13058 |
Length: | 330 |
Species: | Homo sapiens |
Alignment Length: | 66 |
Identity: | 21/66 - (31%) |
Similarity: | 31/66 - (46%) |
Gaps: | 23/66 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 278 DWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNR 342
||:|.:|:|.|:|.|:|||.|.||| |.:..:|...|||::.|
Human 68 DWQCKTCSNVNWARRSECNMCNTPK-----------------------YAKLEERTGYGGGFNER 109
Fly 343 D 343
:
Human 110 E 110
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1995 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.