DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and AT1G67325

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001185341.1 Gene:AT1G67325 / 843053 AraportID:AT1G67325 Length:288 Species:Arabidopsis thaliana


Alignment Length:264 Identity:64/264 - (24%)
Similarity:81/264 - (30%) Gaps:95/264 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 DFNGNAIKVSLAQRQNNWNKGGGGGGGGGGRGGFGGRRGGGGGGGG----------GGGGGGRFD 247
            |.||.:....:..:|...:.|...|.||......||...|.....|          .||....|:
plant    54 DHNGKSAPKPMQHQQGFSSPGAYLGSGGPPPVYMGGSPYGSPLFNGSSMPPYDVPFSGGSPYHFN 118

  Fly   248 ----------------------RGGG--GGGGRY------DRGGGG--GGGGGGGNVQP------ 274
                                  .||.  |.||.|      ||.|.|  .|.|....:.|      
plant   119 YNSRMPAGAHYRPLHMSGPPPYHGGSMMGSGGMYGMPPPIDRYGLGMAMGPGSAAAMMPRPRFYP 183

  Fly   275 ----------RDGDWKCNSCNNTNFAWRNECN--RCKTPKGDDEGSSGGGGGGGYGGGGGGGGYD 327
                      ||.||.|.:|.|.||::|..||  :|.|||               .|...||..|
plant   184 DEKSQKRDSTRDNDWTCPNCGNVNFSFRTVCNMRKCNTPK---------------PGSQQGGSSD 233

  Fly   328 RGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGY---SRFNDNNGGG--RGGRGGGGGNRRDGGP 387
            :.:.:.:..|.: ..|..||.           .|   |:.|..|.|.  .|.|..|..:|   .|
plant   234 KISKQNAPEGSW-KCDNCGNI-----------NYPFRSKCNRQNCGADKPGDRSNGSPSR---AP 283

  Fly   388 MRND 391
            ..||
plant   284 EEND 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796 3/11 (27%)
RRM_SARFH 122..204 CDD:240978 3/10 (30%)
zf-RanBP 275..304 CDD:279035 16/30 (53%)
RanBP2-type Zn finger 279..298 CDD:275375 9/20 (45%)
AT1G67325NP_001185341.1 zf-RanBP 22..52 CDD:279035
ZnF_RBZ 196..222 CDD:197784 11/25 (44%)
RanBP2-type Zn finger 198..219 CDD:275375 9/20 (45%)
zf-RanBP 241..272 CDD:279035 9/42 (21%)
RanBP2-type Zn finger 245..266 CDD:275375 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.