DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and AT5G55550

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001331843.1 Gene:AT5G55550 / 835649 AraportID:AT5G55550 Length:507 Species:Arabidopsis thaliana


Alignment Length:335 Identity:75/335 - (22%)
Similarity:110/335 - (32%) Gaps:98/335 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GGGGSGGNDMITQEDTIFVSGMDPSTTEQDIETHFGAIG-----IIKKDKRTMKPKIWLYKNKET 165
            ||||        :...|||.|:..|.||::.:.:|...|     ::..|..|.:|          
plant   151 GGGG--------RTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRP---------- 197

  Fly   166 GASKGEATVTYDDTNAAQSAI-EWFDGRDFNGNAIKVSLAQRQ-----NNWNK---GGGGGGGGG 221
               :|...:|:|..:|....: :.|  .:.||..::|..|..:     :|...   .|...|||.
plant   198 ---RGFGFITFDSDDAVDRVLHKTF--HELNGKLVEVKRAVPKEISPVSNIRSPLASGVNYGGGS 257

  Fly   222 GR----GGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCN 282
            .|    ..|.....|.|.....|..|.||....|.|.......|.|.......|:.|        
plant   258 NRMPANSYFNNFAPGPGFYNSLGPVGRRFSPVIGSGRNAVSAFGLGLNHDLSLNLNP-------- 314

  Fly   283 SCNNTN--FAWRN----------ECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDR------G 329
            ||:.|:  |.:..          ..||..:|.|.:...|               .|:.      |
plant   315 SCDGTSSTFGYNRIPSNPYFNGASPNRYTSPIGHNRTES---------------PYNSNNRDLWG 364

  Fly   330 NDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGR-------------GGRGGGGGN 381
            |...:.|.|::.....||::|..|.....   :..|||||.||             .|..|..|.
plant   365 NRTDTAGPGWNLNVSNGNNRGNWGLPSSS---AVSNDNNGFGRNYGTSSGLSSSPFNGFEGSIGE 426

  Fly   382 RRDGGPMRND 391
            ...||.:.:|
plant   427 LYRGGSVYSD 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796 20/92 (22%)
RRM_SARFH 122..204 CDD:240978 20/87 (23%)
zf-RanBP 275..304 CDD:279035 7/40 (18%)
RanBP2-type Zn finger 279..298 CDD:275375 5/30 (17%)
AT5G55550NP_001331843.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.