DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and AT5G47620

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001190485.1 Gene:AT5G47620 / 834812 AraportID:AT5G47620 Length:453 Species:Arabidopsis thaliana


Alignment Length:403 Identity:86/403 - (21%)
Similarity:116/403 - (28%) Gaps:168/403 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 YNKGHGGYSGGGGGGGGGGGGGSGGNDMITQEDTIFVSGMDPSTTEQDIETHFGAIG-----IIK 147
            :||.:....|..|.               :....|||.|:..|.||.:.:.:|...|     ::.
plant   111 FNKSNSSLQGSPGP---------------SNSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVM 160

  Fly   148 KDKRTMKPKIWLYKNKETGASKGEATVTYDDTNAAQSAIE-WFDGRDFNGNAIKVSLA------- 204
            .|.||.:|             :|...::||...|....:: .|  .:.||..::|.||       
plant   161 YDHRTQRP-------------RGFGFISYDSEEAVDKVLQKTF--HELNGKMVEVKLAVPKDMAL 210

  Fly   205 ---QRQNNWNKGGGG------------------GGGG-----------GGRGGFGGRRGGGG--- 234
               :.|.|.|..|..                  .|.|           |.||||.....|.|   
plant   211 NTMRNQMNVNSFGTSRISSLLNEYTQGFSPSPISGYGVKPEVRYSPAVGNRGGFSPFGHGYGIEL 275

  Fly   235 ----------GGGGGGGGGGRFDRGGGGGGGRY----DRGGGGGGGGGGGNVQPRDGDWKCNSCN 285
                      |.|..||.|..|..|.....||:    :.||...|.|...|..|::..|      
plant   276 NFEPNQTQNYGSGSSGGFGRPFSPGYAASLGRFGSQMESGGASVGNGSVLNAAPKNHLW------ 334

  Fly   286 NTNFAWRNECNRCKTPKGDDEGSSGGGGGGGY--------GGGGGGGGYDRGNDRGSGGGGYHNR 342
                                     |.||.||        ....|..|.   :..||.|..:...
plant   335 -------------------------GNGGLGYMSNSPISRSSFSGNSGM---SSLGSIGDNWGTV 371

  Fly   343 DRGGNSQGGGGGGGG--------GGGYSR----------FNDN----------NGGGRG-----G 374
            .|..:|..|..||.|        .||||.          ::|:          .|.|.|     .
plant   372 ARARSSYHGERGGVGLEAMRGVHVGGYSSGSSILEADSLYSDSMWLSLPAKAEEGLGMGPLDFMS 436

  Fly   375 RGGGGG-NRRDGG 386
            ||..|. ||:..|
plant   437 RGPAGYINRQPNG 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796 23/102 (23%)
RRM_SARFH 122..204 CDD:240978 21/87 (24%)
zf-RanBP 275..304 CDD:279035 1/28 (4%)
RanBP2-type Zn finger 279..298 CDD:275375 1/18 (6%)
AT5G47620NP_001190485.1 RRM_SF 8..73 CDD:302621
RRM2_DAZAP1 126..205 CDD:240773 23/93 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.