DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and AT4G28990

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001154272.1 Gene:AT4G28990 / 829020 AraportID:AT4G28990 Length:395 Species:Arabidopsis thaliana


Alignment Length:61 Identity:27/61 - (44%)
Similarity:29/61 - (47%) Gaps:11/61 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 GGGGGGRYDRGGGG-----GGGGGGGN----VQPRDGDWKCNS--CNNTNFAWRNECNRCK 299
            ||.|...|.||..|     |..|...|    ||||:|||.|..  |.|.|||.|..|.:||
plant   168 GGAGARPYRRGLDGPEPPHGRDGMSRNNISKVQPREGDWYCLDPLCRNLNFARRESCYKCK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796
RRM_SARFH 122..204 CDD:240978
zf-RanBP 275..304 CDD:279035 14/27 (52%)
RanBP2-type Zn finger 279..298 CDD:275375 9/20 (45%)
AT4G28990NP_001154272.1 DUF4220 <61..>120 CDD:290676
ZnF_RBZ 204..228 CDD:197784 11/23 (48%)
RanBP2-type Zn finger 206..227 CDD:275376 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23238
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.