powered by:
Protein Alignment caz and AT4G28990
DIOPT Version :9
Sequence 1: | NP_523365.2 |
Gene: | caz / 32587 |
FlyBaseID: | FBgn0285954 |
Length: | 399 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001154272.1 |
Gene: | AT4G28990 / 829020 |
AraportID: | AT4G28990 |
Length: | 395 |
Species: | Arabidopsis thaliana |
Alignment Length: | 61 |
Identity: | 27/61 - (44%) |
Similarity: | 29/61 - (47%) |
Gaps: | 11/61 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 250 GGGGGGRYDRGGGG-----GGGGGGGN----VQPRDGDWKCNS--CNNTNFAWRNECNRCK 299
||.|...|.||..| |..|...| ||||:|||.|.. |.|.|||.|..|.:||
plant 168 GGAGARPYRRGLDGPEPPHGRDGMSRNNISKVQPREGDWYCLDPLCRNLNFARRESCYKCK 228
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR23238 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.