DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and AT3G07810

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_850539.1 Gene:AT3G07810 / 819972 AraportID:AT3G07810 Length:495 Species:Arabidopsis thaliana


Alignment Length:363 Identity:91/363 - (25%)
Similarity:118/363 - (32%) Gaps:87/363 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KDSYNKGHGGYSGGGGGGGGGGGGGSGGNDMITQEDTIFVSGMDPSTTEQDIETHFGAIG----- 144
            :|..|..:...|....|..||.|          :...|||.|:..|.||.|.:|:|...|     
plant    83 RDDQNMVNRSNSSSIQGSPGGPG----------RTRKIFVGGLPSSVTESDFKTYFEQFGTTTDV 137

  Fly   145 IIKKDKRTMKPKIWLYKNKETGASKGEATVTYDDTNAAQSA-IEWFDGRDFNGNAIKVSLA---- 204
            ::..|..|.:|             :|...:|||...|.:.. ::.|  .:.||..::|..|    
plant   138 VVMYDHNTQRP-------------RGFGFITYDSEEAVEKVLLKTF--HELNGKMVEVKRAVPKE 187

  Fly   205 ------------------QRQNNWNKGGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGG 251
                              .|.||...|...|......||:|.|..|.....|.|..|......|.
plant   188 LSPGPSRSPLGAGYSYGVNRVNNLLNGYAQGFNPAAVGGYGLRMDGRFSPVGAGRSGFANYSSGY 252

  Fly   252 GGGGRYDRG---GGGGGGGGGGNVQPRDGDWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSGGGG 313
            |....:|:|   |..||....|||....|.......|...|             |...|..||.|
plant   253 GMNVNFDQGLPTGFTGGTNYNGNVDYGRGMSPYYIGNTNRF-------------GPAVGYEGGNG 304

  Fly   314 GGGYG----------GGGGGGGYDRGNDRGS-----GGGGYHNRDRGG--NSQGGGGGGGGGGGY 361
            ||...          |..||..|:..|...:     ||....|....|  .:.|...|..|||..
plant   305 GGNSSFFSSVTRNLWGNNGGLNYNNNNTNSNSNTYMGGSSSGNNTLSGPFGNSGVNWGAPGGGNN 369

  Fly   362 SRFNDNNGGGRGGRGGGGGNRRDGG-PMRNDGGMRSRP 398
            :..|:|...|.||.|..|.....|| ..||.|..::.|
plant   370 AVSNENVKFGYGGNGESGFGLGTGGYAARNPGANKAAP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796 24/114 (21%)
RRM_SARFH 122..204 CDD:240978 23/87 (26%)
zf-RanBP 275..304 CDD:279035 3/28 (11%)
RanBP2-type Zn finger 279..298 CDD:275375 2/18 (11%)
AT3G07810NP_850539.1 RRM_SF 8..78 CDD:418427
RRM <89..286 CDD:223796 53/221 (24%)
RRM2_Hrp1p 109..186 CDD:409767 24/91 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.