DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and Cirbp

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_006241075.3 Gene:Cirbp / 81825 RGDID:620756 Length:176 Species:Rattus norvegicus


Alignment Length:167 Identity:58/167 - (34%)
Similarity:84/167 - (50%) Gaps:18/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 MITQEDTIFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKETGASKGEATVTYDDT 179
            |.:.|..:||.|:...|.||.:|..|...|.|.        ::.:.|::||..|:|...||:::.
  Rat     1 MASDEGKLFVGGLSFDTNEQALEQVFSKYGQIS--------EVVVVKDRETQRSRGFGFVTFENI 57

  Fly   180 NAAQSAIEWFDGRDFNGNAIKVSLAQRQNNWNKGGGGGGGGGGRGGF-GGRRGGGG---GGGGGG 240
            :.|:.|:...:|:..:|..|:|..|.:.::....|..||..||||.| |||..|.|   |||..|
  Rat    58 DDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRG 122

  Fly   241 GGGGRFDRGGGGGGGRYD------RGGGGGGGGGGGN 271
            .|||||:...||.||..|      :||..|....||:
  Rat   123 YGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGS 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796 24/86 (28%)
RRM_SARFH 122..204 CDD:240978 23/81 (28%)
zf-RanBP 275..304 CDD:279035
RanBP2-type Zn finger 279..298 CDD:275375
CirbpXP_006241075.3 RRM_CIRBP_RBM3 6..85 CDD:409883 24/86 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.