DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment caz and Zranb2

DIOPT Version :9

Sequence 1:	NP_523365.2	Gene:	caz / 32587	FlyBaseID:	FBgn0285954	Length:	399	Species:	Drosophila melanogaster
Sequence 2:	NP_059077.1	Gene:	Zranb2 / 53861	MGIID:	1858211	Length:	330	Species:	Mus musculus

Alignment Length:	66	Identity:	21/66 - (31%)
Similarity:	31/66 - (46%)	Gaps:	23/66 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly   278 DWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSGGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNR 342
            ||:|.:|:|.|:|.|:|||.|.|||                       |.:..:|...|||::.|
Mouse    68 DWQCKTCSNVNWARRSECNMCNTPK-----------------------YAKLEERTGYGGGFNER 109

  Fly   343 D 343
            :
Mouse   110 E 110

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
caz	NP_523365.2	RRM	<118..>205	CDD:223796
		RRM_SARFH	122..204	CDD:240978
		zf-RanBP	275..304	CDD:279035	15/25 (60%)
		RanBP2-type Zn finger	279..298	CDD:275375	10/18 (56%)
Zranb2	NP_059077.1	ZnF_RBZ	11..35	CDD:197784
		RanBP2-type Zn finger	13..34	CDD:275376
		ZnF_RBZ	67..91	CDD:197784	12/22 (55%)
		RanBP2-type Zn finger	69..88	CDD:275376	10/18 (56%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	117..330
		Required for nuclear targeting. /evidence=ECO:0000250	151..324
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1995
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900