DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and RBMY1E

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001006118.2 Gene:RBMY1E / 378950 HGNCID:23916 Length:496 Species:Homo sapiens


Alignment Length:338 Identity:82/338 - (24%)
Similarity:121/338 - (35%) Gaps:74/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 IFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKETGASKGEATVTYDDTNAAQSAI 186
            :|:.|::..|.|:.::..||..|.|.        ::.|.|:: |..|:|.|.:|:::...|::|.
Human    10 LFIGGLNRETNEKMLKAVFGKHGPIS--------EVLLIKDR-TSKSRGFAFITFENPADAKNAA 65

  Fly   187 EWFDGRDFNGNAIKVSLAQRQNNWNKGG--GGGGGGGGRGGFGGRRGGGGGGGGGGG----GGGR 245
            :..:|:..:|.||||..|::. ::..||  ........|...|..|...|..||..|    ..|.
Human    66 KDMNGKSLHGKAIKVEQAKKP-SFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGWLPSQEGH 129

  Fly   246 FDRGGGGGGGR--YDRG------GGGGGGGG------GGNVQPRDGDWKCN----SCNNTNF--- 289
            .|.||.....:  |.||      |.....||      ..:...|...|..:    |....|:   
Human   130 LDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRRENYGVP 194

  Fly   290 -------AWRNECNRCKTPKGDDEGSSGGGGGG-----GYGGGGGGGGY-DRG--NDRGSGGGGY 339
                   :|||:  |..| :.|...::.|....     .|.....|..| |.|  |.......||
Human   195 PRRATISSWRND--RMST-RHDGYATNDGNHPSCQETRDYAPPSRGYAYRDNGHSNRDEHSSRGY 256

  Fly   340 HN-------RDRGGNSQGGG----GGGGGGGGYSRFNDNNGGGRGGR-----GGGGGNRRDGGPM 388
            .|       ||....|:|..    |.......|||...|....|..|     ..|.|.|..|...
Human   257 RNHRSSRETRDYAPPSRGHAYRDYGHSRRDESYSRGYRNRRSSRETREYAPPSRGHGYRDYGHSR 321

  Fly   389 RNDG---GMRSRP 398
            |::.   |.|:.|
Human   322 RHESYSRGYRNHP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796 23/82 (28%)
RRM_SARFH 122..204 CDD:240978 23/81 (28%)
zf-RanBP 275..304 CDD:279035 9/42 (21%)
RanBP2-type Zn finger 279..298 CDD:275375 6/32 (19%)
RBMY1ENP_001006118.2 RRM <1..189 CDD:223796 46/188 (24%)
RRM_RBMX_like 7..85 CDD:240828 24/83 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..348 65/272 (24%)
RBM1CTR 174..218 CDD:285341 9/46 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 453..496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.