DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and CG10466

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:95 Identity:27/95 - (28%)
Similarity:41/95 - (43%) Gaps:15/95 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 GGGSGGNDMITQEDTIFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKETGASKGE 171
            ||....:||......|||:|...:.||.|:...|...|.:        ..|.|.::.:||.|||.
  Fly    21 GGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEV--------VNINLIRDSKTGKSKGF 77

  Fly   172 ATVTYDDTNAAQSAIEWFDGRDFNGNAIKV 201
            ..:.|:|..:...|::       |.|.||:
  Fly    78 CFLCYEDQRSTVLAVD-------NLNGIKI 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796 23/84 (27%)
RRM_SARFH 122..204 CDD:240978 23/80 (29%)
zf-RanBP 275..304 CDD:279035
RanBP2-type Zn finger 279..298 CDD:275375
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 25/91 (27%)
RRM <36..>126 CDD:223796 23/80 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.