DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and RBMX

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_002130.2 Gene:RBMX / 27316 HGNCID:9910 Length:391 Species:Homo sapiens


Alignment Length:343 Identity:89/343 - (25%)
Similarity:130/343 - (37%) Gaps:92/343 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 IFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKETGASKGEATVTYDDTNAAQSAI 186
            :|:.|::..|.|:.:|..||..|.|        .::.|.|::||..|:|.|.||::....|:.|.
Human    10 LFIGGLNTETNEKALEAVFGKYGRI--------VEVLLMKDRETNKSRGFAFVTFESPADAKDAA 66

  Fly   187 EWFDGRDFNGNAIKVSLAQRQN--NWNKG--------GGGGGGGGGRGGFGGRRGGGGGGGGGGG 241
            ...:|:..:|.||||..|.:.:  :..:|        |...|..|||||.||.||....||....
Human    67 RDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDD 131

  Fly   242 GG------------------GRFDRGGG----------------GGGGRYDRGGGGGGGGGGGN- 271
            ||                  |...|.||                |.|||.....|....||... 
Human   132 GGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRR 196

  Fly   272 ----------VQPRDGDWKC-NSCNNTNF-AWRNECNRCKTPKG------------DDEGSSGGG 312
                      :.|||..:.. :|.::.:: :.|:..:....|:.            ||..|.|..
Human   197 EPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYS 261

  Fly   313 GGGGYGGGGGGGGYDRG-NDRGSGGGGYHNRDRGGNSQGG---GGGGGGGGGYSRFNDNNGGGRG 373
            ...||       |.||. :|..|||....:.:..|||:..   .|.....||.||::|.:    .
Human   262 DRDGY-------GRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYS----S 315

  Fly   374 GRGGGGGNRRDGGPMRND 391
            .|.|.||:|......|:|
Human   316 SRDGYGGSRDSYSSSRSD 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796 26/82 (32%)
RRM_SARFH 122..204 CDD:240978 26/81 (32%)
zf-RanBP 275..304 CDD:279035 5/42 (12%)
RanBP2-type Zn finger 279..298 CDD:275375 2/20 (10%)
RBMXNP_002130.2 RRM_RBMX_like 7..86 CDD:409816 27/83 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..391 71/284 (25%)
dnaA 165..>306 CDD:237605 30/147 (20%)
RBM1CTR 173..217 CDD:400429 10/43 (23%)
Necessary for the association to nascent RNAPII transcripts and nuclear localization 186..236 8/49 (16%)
Necessary for RNA-binding 333..391 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.