Sequence 1: | NP_523365.2 | Gene: | caz / 32587 | FlyBaseID: | FBgn0285954 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055284.3 | Gene: | RBMXL2 / 27288 | HGNCID: | 17886 | Length: | 392 | Species: | Homo sapiens |
Alignment Length: | 408 | Identity: | 99/408 - (24%) |
---|---|---|---|
Similarity: | 128/408 - (31%) | Gaps: | 158/408 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 122 IFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKETGASKGEATVTYDDTNAAQSAI 186
Fly 187 EWFDGRDFNGNAIKVSLAQRQN-NWNKGGGGGGGGGGRGGF-GGRRGGGGGGGGGGGGGGRFDRG 249
Fly 250 G------------------GGGGGRYD------------RGGGGGGGGGGGNVQPRDGDWKCNSC 284
Fly 285 NNTNFAWRNECNR-CKTPKGD------DEGSSGGGGGG--------------------------- 315
Fly 316 -------GYGGGGGGGGYDR------------------GNDRGS----------GGGGYHNRDRG 345
Fly 346 GNSQGGGGGG-------GGGGGYSRFNDNNG------------------------GGRGGRGGGG 379
Fly 380 GNRRDGGPMRNDGGMRSR 397 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
caz | NP_523365.2 | RRM | <118..>205 | CDD:223796 | 26/82 (32%) |
RRM_SARFH | 122..204 | CDD:240978 | 26/81 (32%) | ||
zf-RanBP | 275..304 | CDD:279035 | 5/29 (17%) | ||
RanBP2-type Zn finger | 279..298 | CDD:275375 | 1/19 (5%) | ||
RBMXL2 | NP_055284.3 | RRM_RBMX_like | 7..86 | CDD:240828 | 27/83 (33%) |
RRM | <9..>81 | CDD:223796 | 24/78 (31%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 67..392 | 79/343 (23%) | |||
RBM1CTR | 173..217 | CDD:285341 | 15/56 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |