DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and RBMXL2

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_055284.3 Gene:RBMXL2 / 27288 HGNCID:17886 Length:392 Species:Homo sapiens


Alignment Length:408 Identity:99/408 - (24%)
Similarity:128/408 - (31%) Gaps:158/408 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 IFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKETGASKGEATVTYDDTNAAQSAI 186
            :|:.|::..|.|:.:|..||..|.|        .::.|.|::||..|:|.|.||::....|::|.
Human    10 LFIGGLNLETDEKALEAEFGKYGRI--------VEVLLMKDRETNKSRGFAFVTFESPADAKAAA 66

  Fly   187 EWFDGRDFNGNAIKVSLAQRQN-NWNKGGGGGGGGGGRGGF-GGRRGGGGGGGGGGGGGGRFDRG 249
            ...:|:..:|.||||:.|.:.. ..::.|.......||..| .|.||||||.......||..|.|
Human    67 RDMNGKSLDGKAIKVAQATKPAFESSRRGPPPPRSRGRPRFLRGTRGGGGGPRRSPSRGGPDDDG 131

  Fly   250 G------------------GGGGGRYD------------RGGGGGGGGGGGNVQPRDGDWKCNSC 284
            |                  |....|..            |..|||..|....|:.|||       
Human   132 GYTADFDLRPSRAPMPMKRGPPPRRVGPPPKRAAPSGPARSSGGGMRGRALAVRGRDG------- 189

  Fly   285 NNTNFAWRNECNR-CKTPKGD------DEGSSGGGGGG--------------------------- 315
                  :.....| ...|:.|      |||.|...|..                           
Human   190 ------YSGPPRREPLPPRRDPYLGPRDEGYSSRDGYSSRDYREPRGFAPSPGEYTHRDYGHSSV 248

  Fly   316 -------GYGGGGGGGGYDR------------------GNDRGS----------GGGGYHNRDRG 345
                   ||....|.||.||                  |..||:          ||||.:...||
Human   249 RDDCPLRGYSDRDGYGGRDRDYGDHLSRGSHREPFESYGELRGAAPGRGTPPSYGGGGRYEEYRG 313

  Fly   346 GNSQGGGGGG-------GGGGGYSRFNDNNG------------------------GGRGGRGGGG 379
            .:.....||.       |....|||.....|                        |.|..|||| 
Human   314 YSPDAYSGGRDSYSSSYGRSDRYSRGRHRVGRPDRGLSLSMERGCPPQRDSYSRSGCRVPRGGG- 377

  Fly   380 GNRRDGGPMRNDGGMRSR 397
               |.||.:...|| |||
Human   378 ---RLGGRLERGGG-RSR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796 26/82 (32%)
RRM_SARFH 122..204 CDD:240978 26/81 (32%)
zf-RanBP 275..304 CDD:279035 5/29 (17%)
RanBP2-type Zn finger 279..298 CDD:275375 1/19 (5%)
RBMXL2NP_055284.3 RRM_RBMX_like 7..86 CDD:240828 27/83 (33%)
RRM <9..>81 CDD:223796 24/78 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..392 79/343 (23%)
RBM1CTR 173..217 CDD:285341 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.