DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and Rbm3

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001159881.1 Gene:Rbm3 / 19652 MGIID:1099460 Length:154 Species:Mus musculus


Alignment Length:173 Identity:55/173 - (31%)
Similarity:81/173 - (46%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 MITQEDTIFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKETGASKGEATVTYDDT 179
            |.::|..:||.|::.:|.||.:|.||.:.|.|.        ::.:.|::||..|:|...:|:.:.
Mouse     1 MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPIS--------EVVVVKDRETQRSRGFGFITFTNP 57

  Fly   180 NAAQSAIEWFDGRDFNGNAIKVSLAQRQNNWNKGGGGGGGGGGRGG-FGGR-RGGGGGGGGGGGG 242
            ..|..|:...:|...:|..|:|..|           |....|.||| |||| |....|||..|.|
Mouse    58 EHASDAMRAMNGESLDGRQIRVDHA-----------GKSARGSRGGAFGGRGRSYSRGGGDQGYG 111

  Fly   243 GGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCN 285
            .||:|...||.|..|.|.....|...||..:...|:::.|..|
Mouse   112 SGRYDSRPGGYGYGYGRSRDYSGRSQGGYDRYSGGNYRDNYDN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796 24/86 (28%)
RRM_SARFH 122..204 CDD:240978 23/81 (28%)
zf-RanBP 275..304 CDD:279035 3/11 (27%)
RanBP2-type Zn finger 279..298 CDD:275375 2/7 (29%)
Rbm3NP_001159881.1 RRM_CIRBP_RBM3 6..85 CDD:240895 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.