DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment caz and CSTF2

DIOPT Version :9

Sequence 1:	NP_523365.2	Gene:	caz / 32587	FlyBaseID:	FBgn0285954	Length:	399	Species:	Drosophila melanogaster
Sequence 2:	NP_001293135.1	Gene:	CSTF2 / 1478	HGNCID:	2484	Length:	597	Species:	Homo sapiens

Alignment Length:	89	Identity:	25/89 - (28%)
Similarity:	43/89 - (48%)	Gaps:	8/89 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   121 TIFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKETGASKGEATVTYDDTNAAQSA 185
            ::||..:....||:.::..|..:|.:...:        |..::|||..||.....|.|...|.||
Human    17 SVFVGNIPYEATEEQLKDIFSEVGPVVSFR--------LVYDRETGKPKGYGFCEYQDQETALSA 73

  Fly   186 IEWFDGRDFNGNAIKVSLAQRQNN 209
            :...:||:|:|.|::|..|..:.|
Human    74 MRNLNGREFSGRALRVDNAASEKN 97

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
caz	NP_523365.2	RRM	<118..>205	CDD:223796	23/83 (28%)
		RRM_SARFH	122..204	CDD:240978	23/81 (28%)
		zf-RanBP	275..304	CDD:279035
		RanBP2-type Zn finger	279..298	CDD:275375
CSTF2	NP_001293135.1	PABP-1234	4..352	CDD:130689	25/89 (28%)
		RRM_CSTF2_CSTF2T	18..92	CDD:241115	23/81 (28%)
		CSTF2_hinge	112..191	CDD:373015
		PRK14718	<412..>469	CDD:173181
		CSTF_C	553..593	CDD:373006
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910