DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caz and LOC110438494

DIOPT Version :9

Sequence 1:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_021326692.1 Gene:LOC110438494 / 110438494 -ID:- Length:312 Species:Danio rerio


Alignment Length:333 Identity:125/333 - (37%)
Similarity:164/333 - (49%) Gaps:63/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 GGYSGGGG---GGGGGGGGGSGGNDMITQEDTIFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMK 154
            ||::..||   ||.....|..|..|  ::..||:::|:..:.|..::...|...|.|:.::|..:
Zfish    17 GGFNKPGGPMRGGMDRDMGHPGEQD--SENSTIYITGLTENATLPEMAEFFKHTGAIRINRRLNQ 79

  Fly   155 PKIWLYKNKETGASKGEATVTYDDTNAAQSAIEWFDGRDFNGNAIKVSLAQRQNNWNKGGGGGGG 219
            |.|.:|.:|::|..||:||::|::...|:.|:|.|||::|.|..:|||:|:|:   ...||..||
Zfish    80 PAINIYTDKDSGKPKGDATLSYEEPAFAKPAVEHFDGKEFQGRRLKVSMARRK---PMIGGMRGG 141

  Fly   220 GGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNS- 283
            ...|||.|..|||..|.||..||   |...||..||.     |..||...||||.|.|||:|.: 
Zfish   142 MPMRGGPGMDRGGMMGRGGERGG---FPPRGGPRGGM-----GWNGGPQPGNVQKRAGDWECPNV 198

  Fly   284 -CNNTNFAWRNECNRCKTPKGDDEGSSG---GGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDR 344
             |.|.||:||.|||:||.||.:..|:|.   .||..|.||..||.|.|||...|.          
Zfish   199 GCGNQNFSWRMECNQCKAPKPEGLGTSPPFYPGGERGRGGMRGGRGMDRGGSEGM---------- 253

  Fly   345 GGNSQGGGGGGGGGGGYSRFNDNNGGGRGG--RGGGGGNRRDGGPM-RNDGGM------------ 394
                  .||.||..||:.        ||||  |||..|..|.|.|| |...||            
Zfish   254 ------RGGWGGDRGGFR--------GRGGMDRGGFRGGSRCGPPMDRGRRGMGPPGKMKMRDHR 304

  Fly   395 ---RSRPY 399
               |.|||
Zfish   305 QERRERPY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cazNP_523365.2 RRM <118..>205 CDD:223796 29/86 (34%)
RRM_SARFH 122..204 CDD:240978 28/81 (35%)
zf-RanBP 275..304 CDD:279035 18/30 (60%)
RanBP2-type Zn finger 279..298 CDD:275375 11/20 (55%)
LOC110438494XP_021326692.1 RRM_SF 45..128 CDD:327398 28/82 (34%)
zf-RanBP 189..219 CDD:279035 17/29 (59%)
RanBP2-type Zn finger 193..214 CDD:275375 11/20 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1539664at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.