DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14 and QCR7

DIOPT Version :9

Sequence 1:NP_573110.1 Gene:UQCR-14 / 32586 FlyBaseID:FBgn0030733 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_010818.1 Gene:QCR7 / 852142 SGDID:S000002937 Length:127 Species:Saccharomyces cerevisiae


Alignment Length:116 Identity:45/116 - (38%)
Similarity:65/116 - (56%) Gaps:10/116 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNYIARKGPAVLSNL----GRWAYNLSGFNQYGLHRDDCL-YENEDVKEAVRRLPRKLYDERNY 60
            :.:||. |.| |||.|    .....||:|:.:.||..||.: .||..::.|:||||......|.|
Yeast    11 IGDYIL-KSP-VLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAY 73

  Fly    61 RIMRALHLSMTKTILPKEQWTKYEEDVKYLEPYLKE---VVKEREEREDWE 108
            ||:||....:|..:||:.:|.|.:|||.||.||:.|   ..||::|.::.|
Yeast    74 RIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14NP_573110.1 UCR_14kD 12..94 CDD:396723 35/86 (41%)
QCR7NP_010818.1 UCR_14kD 19..118 CDD:396723 40/99 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346615
Domainoid 1 1.000 64 1.000 Domainoid score I2428
eggNOG 1 0.900 - - E1_KOG3440
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1718
Isobase 1 0.950 - 0 Normalized mean entropy S1136
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - otm46704
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - LDO PTHR12022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1049
SonicParanoid 1 1.000 - - X3089
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.