DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14 and AT5G25450

DIOPT Version :9

Sequence 1:NP_573110.1 Gene:UQCR-14 / 32586 FlyBaseID:FBgn0030733 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_197927.1 Gene:AT5G25450 / 832619 AraportID:AT5G25450 Length:122 Species:Arabidopsis thaliana


Alignment Length:106 Identity:42/106 - (39%)
Similarity:56/106 - (52%) Gaps:13/106 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NYIARKGPAVLSNLGRWAYNLSGFNQYGLHRDDCLYE---NEDVKEAVRRLPRKLYDERNYRIMR 64
            |::||.....:||..|         :|||..|| ||:   :.|:|||:.||||::.|.||.|:||
plant    14 NFLARMHMKSVSNRLR---------RYGLRYDD-LYDPLYDLDIKEALNRLPREIVDARNQRLMR 68

  Fly    65 ALHLSMTKTILPKEQWTKYEEDVKYLEPYLKEVVKEREERE 105
            |:.|||....||............||:..|..|.:||.|||
plant    69 AMDLSMKHEYLPDNLQAVQTPFRSYLQDMLALVKRERAERE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14NP_573110.1 UCR_14kD 12..94 CDD:396723 32/84 (38%)
AT5G25450NP_197927.1 UCR_14kD 4..109 CDD:396723 40/104 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3891
eggNOG 1 0.900 - - E1_KOG3440
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2554
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1606436at2759
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - mtm1148
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - LDO PTHR12022
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3089
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.