DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14 and AT4G32470

DIOPT Version :9

Sequence 1:NP_573110.1 Gene:UQCR-14 / 32586 FlyBaseID:FBgn0030733 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_194973.1 Gene:AT4G32470 / 829382 AraportID:AT4G32470 Length:122 Species:Arabidopsis thaliana


Alignment Length:105 Identity:38/105 - (36%)
Similarity:54/105 - (51%) Gaps:11/105 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NYIARKGPAVLSNLGRWAYNLSGFNQYGLHRDDCL--YENEDVKEAVRRLPRKLYDERNYRIMRA 65
            |::||.....:|         :...:|||..||..  |.:.|:|||:.||||::.|.||.|:.||
plant    14 NFLARMHMKAIS---------TRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVDARNQRLKRA 69

  Fly    66 LHLSMTKTILPKEQWTKYEEDVKYLEPYLKEVVKEREERE 105
            :.|||....|||:..........||:..|..|.:|.:|||
plant    70 MDLSMKHEYLPKDLQAVQTPFRGYLQDMLALVERESKERE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14NP_573110.1 UCR_14kD 12..94 CDD:396723 29/83 (35%)
AT4G32470NP_194973.1 UCR_14kD 4..109 CDD:396723 36/103 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3891
eggNOG 1 0.900 - - E1_KOG3440
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2554
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1606436at2759
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - mtm1148
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - O PTHR12022
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3089
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.