DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14 and Uqcrb

DIOPT Version :9

Sequence 1:NP_573110.1 Gene:UQCR-14 / 32586 FlyBaseID:FBgn0030733 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_080495.1 Gene:Uqcrb / 67530 MGIID:1914780 Length:111 Species:Mus musculus


Alignment Length:97 Identity:62/97 - (63%)
Similarity:76/97 - (78%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSNLGRWAYNLSGFNQYGLHRDDCLYENEDVKEAVRRLPRKLYDERNYRIMRALHLSMTKTILPK 77
            |....:|.||.:|||:.||.|||.|:|.||||||:||||..||::|.:||.|||.|:|...||||
Mouse    14 LDGFRKWYYNAAGFNKLGLMRDDTLHETEDVKEAIRRLPEDLYNDRMFRIKRALDLTMRHQILPK 78

  Fly    78 EQWTKYEEDVKYLEPYLKEVVKEREEREDWEK 109
            :||||||||..|||||||||::||:|||:|.|
Mouse    79 DQWTKYEEDKFYLEPYLKEVIRERKEREEWAK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14NP_573110.1 UCR_14kD 12..94 CDD:396723 50/80 (63%)
UqcrbNP_080495.1 UCR_14kD 9..106 CDD:396723 58/91 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850323
Domainoid 1 1.000 128 1.000 Domainoid score I5297
eggNOG 1 0.900 - - E1_KOG3440
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38164
Inparanoid 1 1.050 134 1.000 Inparanoid score I4561
Isobase 1 0.950 - 0 Normalized mean entropy S1136
OMA 1 1.010 - - QHG48987
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - otm42965
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - LDO PTHR12022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1049
SonicParanoid 1 1.000 - - X3089
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.